Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1V7E0

Protein Details
Accession K1V7E0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
75-94APSNRSKKARRPKDGLYESEHydrophilic
NLS Segment(s)
PositionSequence
81-85KKARR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MVDSTPPSSSANTPKREMDIDERDEHERHYSSGSDEGEPGASDTELDEAEPIETGQATPPLVEGEAGPSTSTHLAPSNRSKKARRPKDGLYESEIVHRWNRGELED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.44
4 0.43
5 0.42
6 0.41
7 0.41
8 0.41
9 0.41
10 0.42
11 0.4
12 0.37
13 0.33
14 0.26
15 0.22
16 0.21
17 0.19
18 0.17
19 0.21
20 0.22
21 0.18
22 0.17
23 0.16
24 0.14
25 0.13
26 0.12
27 0.07
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.04
43 0.05
44 0.05
45 0.04
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.09
57 0.1
58 0.1
59 0.09
60 0.13
61 0.14
62 0.2
63 0.3
64 0.37
65 0.43
66 0.5
67 0.55
68 0.61
69 0.7
70 0.76
71 0.75
72 0.74
73 0.75
74 0.79
75 0.8
76 0.74
77 0.69
78 0.61
79 0.52
80 0.51
81 0.43
82 0.35
83 0.31
84 0.29
85 0.24
86 0.26