Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409XHW8

Protein Details
Accession A0A409XHW8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSTCKVQDKKKKSENKNKKGGGRMVHydrophilic
NLS Segment(s)
PositionSequence
9-21KKKKSENKNKKGG
Subcellular Location(s) plas 9, mito 5, E.R. 5, vacu 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTCKVQDKKKKSENKNKKGGGRMVVAPAILALTIPTLTLAVPTVSALVLAIPTLMLTIPTVLTLTLAIERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.91
4 0.88
5 0.85
6 0.82
7 0.76
8 0.69
9 0.61
10 0.52
11 0.44
12 0.37
13 0.3
14 0.21
15 0.16
16 0.11
17 0.07
18 0.05
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.02
40 0.02
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.06
52 0.07