Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409X1E6

Protein Details
Accession A0A409X1E6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-69MSNERGAAKRHKRCKTKWQREKPRVYSDAEHydrophilic
NLS Segment(s)
PositionSequence
44-59RGAAKRHKRCKTKWQR
Subcellular Location(s) nucl 13.5, mito 9.5, cyto_nucl 9.333, cyto_mito 7.333
Family & Domain DBs
Amino Acid Sequences MFGFPRLEFQSVKARKKVYEVPWSKARMTAWNGLKQLAKMSNERGAAKRHKRCKTKWQREKPRVYSDAEIIVISDMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.5
4 0.56
5 0.53
6 0.55
7 0.53
8 0.54
9 0.58
10 0.6
11 0.54
12 0.48
13 0.41
14 0.36
15 0.36
16 0.38
17 0.35
18 0.37
19 0.37
20 0.36
21 0.35
22 0.29
23 0.28
24 0.24
25 0.21
26 0.18
27 0.2
28 0.22
29 0.24
30 0.26
31 0.25
32 0.28
33 0.36
34 0.44
35 0.51
36 0.56
37 0.64
38 0.71
39 0.75
40 0.81
41 0.82
42 0.84
43 0.86
44 0.88
45 0.9
46 0.92
47 0.95
48 0.92
49 0.9
50 0.82
51 0.76
52 0.68
53 0.59
54 0.52
55 0.42
56 0.33
57 0.24