Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1V8X8

Protein Details
Accession K1V8X8   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
138-170YTPAPPRNPKTPKSPSKKKKKQEEGPRPSRFVLHydrophilic
NLS Segment(s)
PositionSequence
142-164PPRNPKTPKSPSKKKKKQEEGPR
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSSVMSTPPSSFESPSAHLPGDPLPLQRSTTSPSSAPTTGSIKKSRSLLFWKERKGSRSSGRSRADSSVGSQSALRLDTGPETAEPDARLPDVAELPPVPPVPAIPPQPEVKVSEINLGFVRFYKVKVKGPNGSHTGYTPAPPRNPKTPKSPSKKKKKQEEGPRPSRFVLGTLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.31
4 0.27
5 0.25
6 0.25
7 0.24
8 0.24
9 0.23
10 0.21
11 0.21
12 0.22
13 0.24
14 0.23
15 0.23
16 0.23
17 0.24
18 0.25
19 0.23
20 0.24
21 0.27
22 0.26
23 0.25
24 0.24
25 0.26
26 0.28
27 0.33
28 0.36
29 0.33
30 0.36
31 0.39
32 0.38
33 0.38
34 0.41
35 0.44
36 0.49
37 0.54
38 0.57
39 0.59
40 0.62
41 0.6
42 0.57
43 0.55
44 0.53
45 0.56
46 0.57
47 0.59
48 0.59
49 0.58
50 0.57
51 0.52
52 0.45
53 0.36
54 0.31
55 0.27
56 0.23
57 0.2
58 0.17
59 0.16
60 0.14
61 0.14
62 0.12
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.06
69 0.08
70 0.08
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.06
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.08
85 0.08
86 0.08
87 0.06
88 0.07
89 0.09
90 0.14
91 0.16
92 0.16
93 0.19
94 0.2
95 0.22
96 0.23
97 0.22
98 0.2
99 0.2
100 0.19
101 0.22
102 0.2
103 0.21
104 0.2
105 0.18
106 0.16
107 0.14
108 0.17
109 0.12
110 0.14
111 0.2
112 0.24
113 0.3
114 0.38
115 0.43
116 0.48
117 0.51
118 0.56
119 0.53
120 0.5
121 0.44
122 0.38
123 0.36
124 0.29
125 0.28
126 0.27
127 0.28
128 0.33
129 0.4
130 0.44
131 0.5
132 0.57
133 0.58
134 0.63
135 0.68
136 0.72
137 0.75
138 0.81
139 0.81
140 0.85
141 0.92
142 0.92
143 0.93
144 0.93
145 0.93
146 0.93
147 0.94
148 0.93
149 0.94
150 0.91
151 0.84
152 0.74
153 0.67
154 0.56
155 0.46