Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409XPN5

Protein Details
Accession A0A409XPN5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MIEKTRAIRQREKDTKKRRKKEEGKKREKVTHSSBasic
NLS Segment(s)
PositionSequence
7-29AIRQREKDTKKRRKKEEGKKREK
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MIEKTRAIRQREKDTKKRRKKEEGKKREKVTHSSIVGPDRFLFTCPNPSLPFPSFKRQPSLPTLITFITSPITPPAPALHPTPSSATLDFVFTNAFPPISRSTWLRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.89
3 0.91
4 0.93
5 0.92
6 0.92
7 0.93
8 0.93
9 0.94
10 0.94
11 0.93
12 0.93
13 0.9
14 0.88
15 0.82
16 0.78
17 0.73
18 0.7
19 0.61
20 0.55
21 0.5
22 0.45
23 0.4
24 0.34
25 0.27
26 0.22
27 0.2
28 0.18
29 0.17
30 0.14
31 0.2
32 0.2
33 0.23
34 0.21
35 0.22
36 0.26
37 0.24
38 0.29
39 0.26
40 0.32
41 0.34
42 0.34
43 0.38
44 0.34
45 0.37
46 0.36
47 0.38
48 0.33
49 0.28
50 0.29
51 0.25
52 0.24
53 0.2
54 0.15
55 0.11
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.11
63 0.13
64 0.15
65 0.16
66 0.19
67 0.19
68 0.2
69 0.23
70 0.23
71 0.23
72 0.21
73 0.21
74 0.17
75 0.18
76 0.17
77 0.14
78 0.13
79 0.11
80 0.12
81 0.11
82 0.11
83 0.09
84 0.13
85 0.17
86 0.19
87 0.22
88 0.23