Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XJV4

Protein Details
Accession A0A409XJV4   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
92-121PQTRHVLGQRHQKRHRNKKQQEQETPTPAWHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 13, nucl 4.5, cyto_nucl 4.5, cyto 3.5, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MGEGPYMLTHLTIYSTLWMVNLHDLLSPTTLQAQFKDSHIDLDARPFAFVGVSIEEGGGGPIRGVADVVCASSPHITFSGVPGALDATPLLPQTRHVLGQRHQKRHRNKKQQEQETPTPAWEEPHDILQLVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.09
6 0.09
7 0.11
8 0.11
9 0.1
10 0.11
11 0.12
12 0.12
13 0.13
14 0.12
15 0.1
16 0.14
17 0.16
18 0.16
19 0.16
20 0.18
21 0.18
22 0.19
23 0.24
24 0.19
25 0.18
26 0.19
27 0.2
28 0.17
29 0.2
30 0.22
31 0.17
32 0.16
33 0.15
34 0.13
35 0.11
36 0.11
37 0.08
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.05
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.05
56 0.04
57 0.04
58 0.05
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.08
65 0.09
66 0.12
67 0.1
68 0.1
69 0.09
70 0.09
71 0.08
72 0.09
73 0.07
74 0.05
75 0.05
76 0.06
77 0.07
78 0.06
79 0.07
80 0.11
81 0.13
82 0.16
83 0.2
84 0.25
85 0.31
86 0.42
87 0.51
88 0.57
89 0.65
90 0.7
91 0.78
92 0.84
93 0.89
94 0.89
95 0.9
96 0.9
97 0.92
98 0.94
99 0.93
100 0.91
101 0.88
102 0.83
103 0.74
104 0.64
105 0.56
106 0.45
107 0.38
108 0.3
109 0.28
110 0.23
111 0.25
112 0.25