Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409X7P2

Protein Details
Accession A0A409X7P2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MRIPRKRLHRRRVLMELPHRHBasic
55-75IVIAPTRQRRRPRPAVVAPFQHydrophilic
NLS Segment(s)
PositionSequence
5-12RKRLHRRR
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
Amino Acid Sequences MRIPRKRLHRRRVLMELPHRHIIRDIILASRDRRAPAPTRPRPPGPAQIPYTHLIVIAPTRQRRRPRPAVVAPFQTTHFLPMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.79
4 0.73
5 0.72
6 0.64
7 0.55
8 0.49
9 0.41
10 0.32
11 0.27
12 0.21
13 0.16
14 0.18
15 0.2
16 0.2
17 0.21
18 0.21
19 0.19
20 0.2
21 0.22
22 0.24
23 0.32
24 0.41
25 0.46
26 0.52
27 0.55
28 0.56
29 0.56
30 0.56
31 0.55
32 0.48
33 0.46
34 0.42
35 0.39
36 0.4
37 0.37
38 0.34
39 0.25
40 0.21
41 0.14
42 0.12
43 0.12
44 0.13
45 0.18
46 0.24
47 0.31
48 0.39
49 0.49
50 0.57
51 0.66
52 0.72
53 0.74
54 0.77
55 0.81
56 0.83
57 0.8
58 0.77
59 0.7
60 0.61
61 0.54
62 0.47
63 0.38