Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XUE6

Protein Details
Accession A0A409XUE6   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTRTVRTRARTARARVRARTHydrophilic
NLS Segment(s)
PositionSequence
8-31RARTARARVRARTARARVRARTAR
Subcellular Location(s) nucl 13, mito 11, cyto 2
Family & Domain DBs
Amino Acid Sequences MTRTVRTRARTARARVRARTARARVRARTARARDEDCENEGRYGDGKDGQGEDEDRDRNGEDGQGEDENEDRENEDRDSDSEDGQGKDEDRDSDSKDGENEGRDGDSKDGENEGRNGDSKDGENEGRDGDSKDGENEGRDGDSENGQGKDEDHENEDRDGEDMDVDGEGEDEDNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.77
3 0.79
4 0.77
5 0.76
6 0.77
7 0.75
8 0.75
9 0.76
10 0.79
11 0.74
12 0.76
13 0.77
14 0.74
15 0.75
16 0.72
17 0.71
18 0.69
19 0.67
20 0.59
21 0.58
22 0.53
23 0.46
24 0.44
25 0.37
26 0.31
27 0.28
28 0.25
29 0.2
30 0.17
31 0.15
32 0.14
33 0.13
34 0.14
35 0.14
36 0.14
37 0.14
38 0.14
39 0.15
40 0.16
41 0.16
42 0.15
43 0.15
44 0.15
45 0.14
46 0.14
47 0.14
48 0.1
49 0.1
50 0.11
51 0.11
52 0.1
53 0.1
54 0.1
55 0.09
56 0.09
57 0.08
58 0.07
59 0.08
60 0.1
61 0.1
62 0.1
63 0.1
64 0.1
65 0.14
66 0.14
67 0.13
68 0.13
69 0.15
70 0.14
71 0.14
72 0.14
73 0.11
74 0.11
75 0.11
76 0.1
77 0.1
78 0.11
79 0.13
80 0.15
81 0.15
82 0.14
83 0.14
84 0.15
85 0.15
86 0.14
87 0.12
88 0.1
89 0.11
90 0.11
91 0.12
92 0.11
93 0.1
94 0.1
95 0.1
96 0.11
97 0.12
98 0.12
99 0.12
100 0.13
101 0.13
102 0.14
103 0.14
104 0.13
105 0.14
106 0.13
107 0.14
108 0.16
109 0.16
110 0.15
111 0.15
112 0.14
113 0.13
114 0.13
115 0.12
116 0.1
117 0.1
118 0.1
119 0.1
120 0.11
121 0.12
122 0.12
123 0.11
124 0.11
125 0.1
126 0.1
127 0.11
128 0.11
129 0.12
130 0.14
131 0.17
132 0.17
133 0.18
134 0.18
135 0.16
136 0.19
137 0.2
138 0.19
139 0.2
140 0.23
141 0.24
142 0.25
143 0.25
144 0.22
145 0.19
146 0.18
147 0.14
148 0.11
149 0.09
150 0.08
151 0.07
152 0.07
153 0.06
154 0.06
155 0.05