Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XIU3

Protein Details
Accession A0A409XIU3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
205-230HNGYGPRRHVPPRRQRGRQGDDHDTRBasic
NLS Segment(s)
PositionSequence
216-219PRRQ
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MRTARTRAATATARTARARARTATARTRTATARTRTTTATARTARARVRTRTARTRAATATARTARTRTATAMARTRTARTRAATATARTARARTRTVTARTRTARTRAATATARTARVGTRTATARARTRTVMARTWTARARMRTTRDDGTNAYHHSDDDTRRQHRHNNDTDTYRDRYGPQRPAMKGPMGARRGTADDDTDTYHNGYGPRRHVPPRRQRGRQGDDHDTRRRQRSVPRHVQTIPTCTTAGTVDDNTQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.43
4 0.44
5 0.45
6 0.39
7 0.42
8 0.45
9 0.51
10 0.57
11 0.57
12 0.56
13 0.54
14 0.54
15 0.51
16 0.5
17 0.52
18 0.48
19 0.5
20 0.49
21 0.49
22 0.47
23 0.48
24 0.47
25 0.42
26 0.45
27 0.4
28 0.41
29 0.43
30 0.46
31 0.46
32 0.49
33 0.53
34 0.5
35 0.56
36 0.62
37 0.65
38 0.7
39 0.72
40 0.71
41 0.66
42 0.66
43 0.57
44 0.55
45 0.53
46 0.45
47 0.48
48 0.44
49 0.44
50 0.41
51 0.4
52 0.36
53 0.33
54 0.32
55 0.24
56 0.25
57 0.27
58 0.3
59 0.36
60 0.35
61 0.36
62 0.36
63 0.37
64 0.37
65 0.36
66 0.37
67 0.32
68 0.35
69 0.33
70 0.39
71 0.41
72 0.38
73 0.44
74 0.43
75 0.45
76 0.41
77 0.42
78 0.39
79 0.38
80 0.38
81 0.3
82 0.31
83 0.33
84 0.39
85 0.45
86 0.44
87 0.48
88 0.48
89 0.51
90 0.5
91 0.48
92 0.47
93 0.41
94 0.43
95 0.36
96 0.4
97 0.41
98 0.4
99 0.45
100 0.41
101 0.39
102 0.34
103 0.33
104 0.27
105 0.23
106 0.22
107 0.13
108 0.14
109 0.15
110 0.18
111 0.2
112 0.23
113 0.26
114 0.27
115 0.28
116 0.25
117 0.26
118 0.28
119 0.28
120 0.29
121 0.26
122 0.28
123 0.27
124 0.3
125 0.29
126 0.29
127 0.3
128 0.29
129 0.33
130 0.35
131 0.39
132 0.4
133 0.43
134 0.42
135 0.4
136 0.39
137 0.34
138 0.32
139 0.3
140 0.26
141 0.23
142 0.19
143 0.18
144 0.18
145 0.2
146 0.19
147 0.24
148 0.31
149 0.34
150 0.38
151 0.41
152 0.47
153 0.52
154 0.59
155 0.59
156 0.59
157 0.58
158 0.58
159 0.59
160 0.56
161 0.5
162 0.42
163 0.35
164 0.31
165 0.33
166 0.38
167 0.41
168 0.43
169 0.47
170 0.48
171 0.52
172 0.52
173 0.47
174 0.44
175 0.41
176 0.43
177 0.38
178 0.36
179 0.32
180 0.3
181 0.3
182 0.28
183 0.24
184 0.18
185 0.17
186 0.18
187 0.2
188 0.18
189 0.17
190 0.16
191 0.15
192 0.15
193 0.16
194 0.21
195 0.24
196 0.28
197 0.33
198 0.38
199 0.47
200 0.55
201 0.63
202 0.69
203 0.74
204 0.79
205 0.82
206 0.86
207 0.88
208 0.86
209 0.85
210 0.82
211 0.81
212 0.79
213 0.8
214 0.79
215 0.77
216 0.77
217 0.75
218 0.72
219 0.68
220 0.69
221 0.72
222 0.74
223 0.76
224 0.74
225 0.73
226 0.71
227 0.74
228 0.68
229 0.64
230 0.56
231 0.47
232 0.42
233 0.34
234 0.33
235 0.25
236 0.22
237 0.19
238 0.18