Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XIN4

Protein Details
Accession A0A409XIN4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-109EGLRSRPIFPKPKPKPKARNPACVHVHHydrophilic
NLS Segment(s)
PositionSequence
76-101KGEGRGKEGLRSRPIFPKPKPKPKAR
Subcellular Location(s) cyto 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MGGTGGFEICVDSSHVDLDTGGIVLVKTKSRVALDGVWLGAGAGAGAGAGAGAGAGAGAGGAMGEVTNVMEADRDKGEGRGKEGLRSRPIFPKPKPKPKARNPACVHVHHAAYAFTSSSAFTSTSNSNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.09
5 0.09
6 0.07
7 0.06
8 0.06
9 0.05
10 0.05
11 0.07
12 0.09
13 0.1
14 0.11
15 0.12
16 0.15
17 0.16
18 0.17
19 0.18
20 0.19
21 0.2
22 0.19
23 0.18
24 0.15
25 0.14
26 0.12
27 0.09
28 0.07
29 0.04
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.01
36 0.01
37 0.01
38 0.01
39 0.01
40 0.01
41 0.01
42 0.01
43 0.01
44 0.01
45 0.01
46 0.01
47 0.01
48 0.01
49 0.01
50 0.01
51 0.01
52 0.01
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.06
60 0.06
61 0.07
62 0.08
63 0.1
64 0.16
65 0.16
66 0.19
67 0.24
68 0.24
69 0.29
70 0.34
71 0.38
72 0.4
73 0.42
74 0.42
75 0.43
76 0.51
77 0.54
78 0.55
79 0.6
80 0.64
81 0.72
82 0.78
83 0.8
84 0.83
85 0.85
86 0.9
87 0.87
88 0.87
89 0.81
90 0.82
91 0.77
92 0.69
93 0.65
94 0.58
95 0.51
96 0.41
97 0.36
98 0.27
99 0.22
100 0.2
101 0.15
102 0.1
103 0.1
104 0.09
105 0.09
106 0.1
107 0.1
108 0.09
109 0.13