Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409XEA4

Protein Details
Accession A0A409XEA4    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
51-71LYNCMRRTPMPKKSHKPTINYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MPIHIEKLKVRPRKAAQAAVCSPQLASMLACWAAHSDLHSVGPCQEHAQTLYNCMRRTPMPKKSHKPTINYHLARLGKSIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.68
3 0.63
4 0.63
5 0.62
6 0.55
7 0.5
8 0.39
9 0.32
10 0.24
11 0.21
12 0.13
13 0.1
14 0.06
15 0.07
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.08
31 0.09
32 0.09
33 0.09
34 0.1
35 0.15
36 0.14
37 0.19
38 0.25
39 0.29
40 0.28
41 0.28
42 0.29
43 0.28
44 0.37
45 0.41
46 0.45
47 0.5
48 0.61
49 0.7
50 0.77
51 0.84
52 0.81
53 0.78
54 0.77
55 0.77
56 0.77
57 0.69
58 0.63
59 0.6
60 0.56
61 0.5