Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WTW9

Protein Details
Accession A0A409WTW9    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-46QEKLFKPTTKLQPPRPRARPPKEKEEGEBasic
68-92NPEIARKERKIRKGRPTAQPKRPSTBasic
NLS Segment(s)
PositionSequence
29-89LQPPRPRARPPKEKEEGEIRNGKAKLKRREGRALSEATRNPEIARKERKIRKGRPTAQPKR
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MSQDKGHGSKCPRPLQTGQEKLFKPTTKLQPPRPRARPPKEKEEGEIRNGKAKLKRREGRALSEATRNPEIARKERKIRKGRPTAQPKRPSTLDWGEDDDVEIKRLSMPPAQRQKGMAAESQTKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.66
4 0.68
5 0.63
6 0.63
7 0.6
8 0.59
9 0.6
10 0.52
11 0.47
12 0.46
13 0.52
14 0.54
15 0.62
16 0.67
17 0.71
18 0.78
19 0.84
20 0.83
21 0.84
22 0.84
23 0.86
24 0.86
25 0.82
26 0.83
27 0.8
28 0.73
29 0.67
30 0.66
31 0.59
32 0.54
33 0.54
34 0.44
35 0.43
36 0.42
37 0.43
38 0.39
39 0.45
40 0.49
41 0.53
42 0.58
43 0.57
44 0.66
45 0.64
46 0.64
47 0.58
48 0.52
49 0.43
50 0.43
51 0.38
52 0.32
53 0.3
54 0.24
55 0.21
56 0.22
57 0.24
58 0.27
59 0.34
60 0.36
61 0.45
62 0.52
63 0.62
64 0.67
65 0.73
66 0.76
67 0.79
68 0.81
69 0.82
70 0.86
71 0.86
72 0.86
73 0.87
74 0.79
75 0.75
76 0.68
77 0.6
78 0.56
79 0.53
80 0.45
81 0.38
82 0.39
83 0.33
84 0.31
85 0.3
86 0.25
87 0.19
88 0.17
89 0.15
90 0.11
91 0.12
92 0.14
93 0.16
94 0.19
95 0.25
96 0.34
97 0.45
98 0.48
99 0.48
100 0.48
101 0.5
102 0.5
103 0.47
104 0.41
105 0.36