Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WPF1

Protein Details
Accession A0A409WPF1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-79LPLPPSPPPKYNKRNRHRTDPIHAHRPVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, extr 5, mito 4, E.R. 3
Family & Domain DBs
Amino Acid Sequences MSGLSSMRAEIASSTVFVSLVCFATIPLLLGTRIPEAEQVPDALQVTSIIFLPLPPSPPPKYNKRNRHRTDPIHAHRPVHRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.09
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.07
12 0.08
13 0.07
14 0.06
15 0.06
16 0.06
17 0.06
18 0.08
19 0.07
20 0.08
21 0.07
22 0.08
23 0.08
24 0.09
25 0.09
26 0.09
27 0.08
28 0.09
29 0.09
30 0.07
31 0.07
32 0.06
33 0.06
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.06
40 0.07
41 0.09
42 0.11
43 0.16
44 0.2
45 0.26
46 0.32
47 0.4
48 0.5
49 0.58
50 0.67
51 0.73
52 0.81
53 0.82
54 0.88
55 0.88
56 0.85
57 0.85
58 0.86
59 0.84
60 0.82
61 0.78
62 0.72