Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XMS3

Protein Details
Accession A0A409XMS3   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
153-177RVEGGGKKAKKPKIEKKKADEDIEMBasic
NLS Segment(s)
PositionSequence
156-171EGGGKKAKKPKIEKKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046938  DNA_clamp_sf  
IPR000730  Pr_cel_nuc_antig  
IPR022648  Pr_cel_nuc_antig_N  
Gene Ontology GO:0003677  F:DNA binding  
GO:0030337  F:DNA polymerase processivity factor activity  
GO:0006275  P:regulation of DNA replication  
Pfam View protein in Pfam  
PF00705  PCNA_N  
Amino Acid Sequences MLLGVNQTSLTKVLRCTKDDGICTLNAADEADVLNLVYETKNSDRIDEYSMKLMDINAGTLTVPRPNTTRVSRSPRPSSRASXLTHLTSLPLDSDRIDEYSMKLMDINAGTLTVPRPNTTRVSRSPRPSSRASGGGRGGGWGGGDQEAKEEENRVEGGGKKAKKPKIEKKKADEDIEMVEDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.4
4 0.46
5 0.5
6 0.5
7 0.48
8 0.41
9 0.36
10 0.35
11 0.29
12 0.22
13 0.16
14 0.14
15 0.1
16 0.07
17 0.07
18 0.06
19 0.06
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.09
27 0.11
28 0.18
29 0.18
30 0.2
31 0.22
32 0.23
33 0.28
34 0.28
35 0.27
36 0.26
37 0.26
38 0.24
39 0.22
40 0.2
41 0.17
42 0.14
43 0.13
44 0.07
45 0.07
46 0.07
47 0.08
48 0.09
49 0.09
50 0.1
51 0.11
52 0.12
53 0.15
54 0.21
55 0.24
56 0.29
57 0.34
58 0.43
59 0.48
60 0.54
61 0.61
62 0.61
63 0.61
64 0.59
65 0.56
66 0.52
67 0.48
68 0.44
69 0.39
70 0.35
71 0.33
72 0.29
73 0.25
74 0.21
75 0.18
76 0.14
77 0.1
78 0.09
79 0.07
80 0.08
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.13
87 0.13
88 0.12
89 0.12
90 0.11
91 0.13
92 0.13
93 0.13
94 0.07
95 0.07
96 0.07
97 0.08
98 0.09
99 0.09
100 0.1
101 0.11
102 0.12
103 0.15
104 0.21
105 0.24
106 0.29
107 0.34
108 0.43
109 0.48
110 0.54
111 0.61
112 0.61
113 0.61
114 0.6
115 0.57
116 0.52
117 0.53
118 0.47
119 0.43
120 0.39
121 0.35
122 0.31
123 0.26
124 0.22
125 0.15
126 0.13
127 0.08
128 0.07
129 0.07
130 0.08
131 0.07
132 0.08
133 0.09
134 0.1
135 0.11
136 0.12
137 0.11
138 0.13
139 0.13
140 0.13
141 0.15
142 0.17
143 0.23
144 0.29
145 0.33
146 0.38
147 0.47
148 0.53
149 0.59
150 0.67
151 0.72
152 0.75
153 0.83
154 0.85
155 0.85
156 0.9
157 0.89
158 0.83
159 0.75
160 0.66
161 0.59
162 0.51
163 0.42