Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VE21

Protein Details
Accession K1VE21    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
202-222GQQGHGHPPTKSKKHKKCVVLBasic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR020849  Small_GTPase_Ras-type  
Gene Ontology GO:0016020  C:membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
PS51420  RHO  
Amino Acid Sequences MSQASRMVFKITVLGDGGVGKTALTVQFTMSSFVETYDPTIEDCYRKQWVVDDQPCLLEVLDTAGQEEYTALRDQWIRDGEGFLVVYSIASRSTFDRVEKIVERVLLVKDEASYNATDSAGYPHGHGNGQHTTRTPIVIVGNKRDQYNDREVSTEEGRLLAMNLGCEFFETSARLNQNVEAAFKALVRQIKVAKSGPEYAHGQQGHGHPPTKSKKHKKCVVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.14
4 0.14
5 0.1
6 0.09
7 0.07
8 0.06
9 0.08
10 0.08
11 0.09
12 0.09
13 0.1
14 0.13
15 0.14
16 0.17
17 0.15
18 0.16
19 0.15
20 0.16
21 0.16
22 0.12
23 0.14
24 0.12
25 0.13
26 0.11
27 0.15
28 0.15
29 0.18
30 0.18
31 0.21
32 0.23
33 0.23
34 0.23
35 0.25
36 0.31
37 0.39
38 0.42
39 0.41
40 0.38
41 0.38
42 0.37
43 0.33
44 0.25
45 0.14
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.09
55 0.06
56 0.07
57 0.08
58 0.07
59 0.09
60 0.11
61 0.12
62 0.17
63 0.18
64 0.17
65 0.16
66 0.17
67 0.15
68 0.15
69 0.14
70 0.09
71 0.07
72 0.06
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.05
79 0.06
80 0.09
81 0.11
82 0.12
83 0.14
84 0.14
85 0.18
86 0.18
87 0.19
88 0.17
89 0.16
90 0.15
91 0.15
92 0.15
93 0.11
94 0.1
95 0.09
96 0.08
97 0.08
98 0.08
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.08
107 0.09
108 0.09
109 0.1
110 0.1
111 0.11
112 0.12
113 0.12
114 0.14
115 0.18
116 0.19
117 0.19
118 0.19
119 0.2
120 0.2
121 0.2
122 0.16
123 0.13
124 0.14
125 0.19
126 0.2
127 0.23
128 0.28
129 0.3
130 0.3
131 0.31
132 0.31
133 0.31
134 0.38
135 0.36
136 0.3
137 0.3
138 0.3
139 0.32
140 0.31
141 0.26
142 0.17
143 0.14
144 0.13
145 0.12
146 0.11
147 0.09
148 0.08
149 0.08
150 0.08
151 0.08
152 0.08
153 0.09
154 0.09
155 0.07
156 0.09
157 0.09
158 0.1
159 0.16
160 0.17
161 0.18
162 0.18
163 0.18
164 0.2
165 0.2
166 0.2
167 0.15
168 0.15
169 0.14
170 0.13
171 0.14
172 0.14
173 0.17
174 0.17
175 0.21
176 0.24
177 0.27
178 0.32
179 0.34
180 0.34
181 0.35
182 0.4
183 0.37
184 0.36
185 0.38
186 0.35
187 0.4
188 0.36
189 0.32
190 0.31
191 0.34
192 0.36
193 0.36
194 0.37
195 0.3
196 0.4
197 0.49
198 0.55
199 0.62
200 0.67
201 0.73
202 0.81