Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XQU1

Protein Details
Accession A0A409XQU1    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-66SPSSSPSAWRSPRKRQRVDMPKKQAKEMHydrophilic
NLS Segment(s)
PositionSequence
52-53KR
113-121VMKRKGSKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MPSTRQHSVSPRKLPHSSDTELFETPVRKRYRSINEDESPSSSPSAWRSPRKRQRVDMPKKQAKEMELEKILRRIVAQPNNHDAIVALKSLPRDETSPRLLVKHLMRSAKAAVMKRKGSKKVRLLETELYMDWLNELNYVHSALFTCLNTKVPNTRKRLPGLGRVSYTILYNLVDEFIDEVNTHHDRPCSLNSPEPCLYPATMTLVEEAKDPSTDERSEEAVELAEHALKAIDKVLADAVRRYKAECGRNNPSLAQRISAQQHALAKGCCLLCEQTGYGTDESDMGDTLMEETREVMEHWKNEYEDCEDQLVDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.68
3 0.64
4 0.59
5 0.53
6 0.5
7 0.46
8 0.42
9 0.38
10 0.35
11 0.32
12 0.31
13 0.35
14 0.35
15 0.33
16 0.36
17 0.45
18 0.53
19 0.56
20 0.61
21 0.62
22 0.62
23 0.66
24 0.65
25 0.58
26 0.5
27 0.43
28 0.36
29 0.27
30 0.24
31 0.23
32 0.31
33 0.36
34 0.44
35 0.51
36 0.61
37 0.71
38 0.79
39 0.83
40 0.82
41 0.85
42 0.86
43 0.88
44 0.88
45 0.89
46 0.87
47 0.81
48 0.77
49 0.7
50 0.6
51 0.57
52 0.51
53 0.47
54 0.44
55 0.45
56 0.42
57 0.41
58 0.4
59 0.32
60 0.29
61 0.27
62 0.31
63 0.36
64 0.39
65 0.41
66 0.46
67 0.47
68 0.46
69 0.39
70 0.3
71 0.25
72 0.21
73 0.16
74 0.1
75 0.1
76 0.11
77 0.12
78 0.13
79 0.11
80 0.13
81 0.16
82 0.21
83 0.24
84 0.27
85 0.27
86 0.27
87 0.26
88 0.3
89 0.31
90 0.33
91 0.34
92 0.33
93 0.33
94 0.34
95 0.34
96 0.32
97 0.33
98 0.3
99 0.32
100 0.36
101 0.4
102 0.45
103 0.51
104 0.57
105 0.6
106 0.65
107 0.66
108 0.68
109 0.69
110 0.66
111 0.64
112 0.57
113 0.51
114 0.44
115 0.35
116 0.28
117 0.21
118 0.17
119 0.12
120 0.1
121 0.08
122 0.07
123 0.07
124 0.06
125 0.06
126 0.07
127 0.07
128 0.06
129 0.07
130 0.07
131 0.08
132 0.08
133 0.09
134 0.09
135 0.11
136 0.11
137 0.12
138 0.19
139 0.25
140 0.33
141 0.39
142 0.44
143 0.47
144 0.49
145 0.55
146 0.51
147 0.52
148 0.5
149 0.46
150 0.4
151 0.37
152 0.35
153 0.28
154 0.25
155 0.16
156 0.11
157 0.08
158 0.08
159 0.06
160 0.06
161 0.05
162 0.05
163 0.06
164 0.05
165 0.05
166 0.05
167 0.05
168 0.1
169 0.11
170 0.12
171 0.13
172 0.13
173 0.14
174 0.17
175 0.21
176 0.22
177 0.22
178 0.28
179 0.27
180 0.34
181 0.34
182 0.31
183 0.28
184 0.24
185 0.22
186 0.17
187 0.16
188 0.13
189 0.12
190 0.12
191 0.12
192 0.11
193 0.11
194 0.12
195 0.12
196 0.09
197 0.09
198 0.1
199 0.1
200 0.14
201 0.14
202 0.15
203 0.16
204 0.17
205 0.17
206 0.17
207 0.15
208 0.12
209 0.11
210 0.1
211 0.08
212 0.08
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.07
219 0.07
220 0.07
221 0.08
222 0.1
223 0.12
224 0.13
225 0.17
226 0.2
227 0.23
228 0.23
229 0.24
230 0.28
231 0.34
232 0.43
233 0.46
234 0.51
235 0.55
236 0.59
237 0.6
238 0.56
239 0.53
240 0.51
241 0.44
242 0.38
243 0.31
244 0.33
245 0.34
246 0.34
247 0.29
248 0.26
249 0.29
250 0.29
251 0.31
252 0.25
253 0.22
254 0.24
255 0.23
256 0.2
257 0.18
258 0.18
259 0.16
260 0.19
261 0.18
262 0.16
263 0.18
264 0.21
265 0.19
266 0.18
267 0.17
268 0.14
269 0.15
270 0.13
271 0.1
272 0.07
273 0.07
274 0.07
275 0.08
276 0.1
277 0.09
278 0.09
279 0.09
280 0.1
281 0.11
282 0.12
283 0.17
284 0.2
285 0.23
286 0.27
287 0.31
288 0.31
289 0.32
290 0.35
291 0.35
292 0.32
293 0.32
294 0.3
295 0.25