Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2LSD9

Protein Details
Accession E2LSD9    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-24HGPRLSGGKRRERRKTVTFDERMBasic
NLS Segment(s)
PositionSequence
9-15GKRRERR
Subcellular Location(s) nucl 18, mito 5, cyto 3
Family & Domain DBs
KEGG mpr:MPER_09946  -  
Amino Acid Sequences MHGPRLSGGKRRERRKTVTFDERMDVMEFERDEYNEEAVEDSEDDYGPGYDDDDDADHPFYQNHLRQEPSHDVDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.81
4 0.79
5 0.8
6 0.75
7 0.67
8 0.61
9 0.53
10 0.46
11 0.38
12 0.28
13 0.18
14 0.16
15 0.13
16 0.13
17 0.13
18 0.11
19 0.12
20 0.13
21 0.13
22 0.1
23 0.1
24 0.08
25 0.08
26 0.08
27 0.06
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.07
41 0.08
42 0.09
43 0.1
44 0.1
45 0.1
46 0.1
47 0.12
48 0.19
49 0.23
50 0.28
51 0.31
52 0.34
53 0.35
54 0.43
55 0.49