Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2LS36

Protein Details
Accession E2LS36    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
170-208VEAQREKERRRWQEAKRRWRKEKRCGREVKRRGGKERLIBasic
NLS Segment(s)
PositionSequence
175-219EKERRRWQEAKRRWRKEKRCGREVKRRGGKERLIGRRESVVGRRR
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, mito 4, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036537  Adaptor_Cbl_N_dom_sf  
Gene Ontology GO:0007166  P:cell surface receptor signaling pathway  
KEGG mpr:MPER_09826  -  
CDD cd21037  MLKL_NTD  
Amino Acid Sequences MTIGHTAAEHAATALAVIGEAIPPVKAVAALSSITDLSRAAQGNTDEAFRLGNFAEDMLQRLLNALNGAQDFSPEVSAAIGRELQVLQSVLDEILVALQELQPKNTICNRLTRSLNLNARDHKEKLAQLQKKLEDAFRAYLFGNIKAIRTDLARLRGNSNRWDRNISYLVEAQREKERRRWQEAKRRWRKEKRCGREVKRRGGKERLIGRRESVVGRRRSVVGSKEPSIVKLVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.08
17 0.08
18 0.08
19 0.09
20 0.09
21 0.09
22 0.09
23 0.08
24 0.08
25 0.12
26 0.12
27 0.12
28 0.15
29 0.16
30 0.18
31 0.19
32 0.18
33 0.14
34 0.13
35 0.14
36 0.1
37 0.11
38 0.08
39 0.09
40 0.08
41 0.08
42 0.09
43 0.09
44 0.12
45 0.11
46 0.11
47 0.1
48 0.11
49 0.11
50 0.09
51 0.09
52 0.07
53 0.08
54 0.08
55 0.09
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.07
70 0.07
71 0.06
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.05
78 0.05
79 0.05
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.04
86 0.09
87 0.09
88 0.1
89 0.12
90 0.12
91 0.16
92 0.19
93 0.23
94 0.2
95 0.28
96 0.3
97 0.34
98 0.35
99 0.34
100 0.35
101 0.37
102 0.41
103 0.37
104 0.37
105 0.35
106 0.38
107 0.39
108 0.36
109 0.3
110 0.29
111 0.27
112 0.31
113 0.37
114 0.38
115 0.38
116 0.42
117 0.41
118 0.4
119 0.4
120 0.34
121 0.26
122 0.24
123 0.23
124 0.18
125 0.18
126 0.15
127 0.18
128 0.18
129 0.16
130 0.16
131 0.14
132 0.14
133 0.13
134 0.14
135 0.11
136 0.11
137 0.14
138 0.15
139 0.21
140 0.24
141 0.25
142 0.29
143 0.34
144 0.36
145 0.41
146 0.46
147 0.46
148 0.45
149 0.49
150 0.45
151 0.45
152 0.45
153 0.38
154 0.32
155 0.31
156 0.3
157 0.29
158 0.29
159 0.25
160 0.31
161 0.37
162 0.37
163 0.42
164 0.51
165 0.54
166 0.64
167 0.71
168 0.73
169 0.77
170 0.84
171 0.87
172 0.88
173 0.9
174 0.91
175 0.93
176 0.93
177 0.93
178 0.93
179 0.92
180 0.91
181 0.92
182 0.9
183 0.9
184 0.89
185 0.89
186 0.88
187 0.86
188 0.83
189 0.82
190 0.78
191 0.76
192 0.77
193 0.76
194 0.7
195 0.64
196 0.59
197 0.55
198 0.51
199 0.47
200 0.46
201 0.45
202 0.47
203 0.48
204 0.48
205 0.46
206 0.47
207 0.48
208 0.45
209 0.46
210 0.47
211 0.46
212 0.49
213 0.48
214 0.45