Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409XN42

Protein Details
Accession A0A409XN42    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
49-78DRELEPPQPPRRKPRPLQRRKNPVSKVIKEBasic
NLS Segment(s)
PositionSequence
57-75PPRRKPRPLQRRKNPVSKV
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MEEEIFEVSLWAGIAENYQWGLDDGENQEENVYADVPASWNHNDREGNDRELEPPQPPRRKPRPLQRRKNPVSKVIKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.06
6 0.06
7 0.06
8 0.08
9 0.07
10 0.1
11 0.1
12 0.13
13 0.14
14 0.13
15 0.12
16 0.11
17 0.12
18 0.09
19 0.08
20 0.05
21 0.05
22 0.05
23 0.05
24 0.06
25 0.08
26 0.09
27 0.11
28 0.12
29 0.16
30 0.17
31 0.18
32 0.24
33 0.24
34 0.26
35 0.25
36 0.25
37 0.23
38 0.24
39 0.24
40 0.21
41 0.28
42 0.35
43 0.42
44 0.47
45 0.56
46 0.64
47 0.73
48 0.79
49 0.81
50 0.83
51 0.85
52 0.91
53 0.92
54 0.93
55 0.92
56 0.92
57 0.87
58 0.86