Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XM79

Protein Details
Accession A0A409XM79   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-99RGPGRNWGRRCRPPCRRHEALBasic
NLS Segment(s)
Subcellular Location(s) mito 16, extr 4, cyto 3, plas 1, pero 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MIAIKRMHVLSTASFFPTTAISPFPFSLRRLALFTAAIVTVATVPHPLPPFSPRDGLVITVCEADRVTAASLLLKWEGRGPGRNWGRRCRPPCRRHEALVRACTVSSSPLTVALPLGIPTWGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.17
4 0.17
5 0.15
6 0.13
7 0.14
8 0.13
9 0.15
10 0.16
11 0.18
12 0.2
13 0.2
14 0.23
15 0.23
16 0.24
17 0.23
18 0.23
19 0.22
20 0.2
21 0.18
22 0.14
23 0.12
24 0.1
25 0.07
26 0.07
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.09
33 0.1
34 0.1
35 0.11
36 0.14
37 0.17
38 0.18
39 0.2
40 0.17
41 0.18
42 0.18
43 0.18
44 0.16
45 0.13
46 0.11
47 0.1
48 0.09
49 0.07
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.07
61 0.07
62 0.07
63 0.09
64 0.12
65 0.13
66 0.18
67 0.19
68 0.28
69 0.37
70 0.44
71 0.46
72 0.53
73 0.61
74 0.65
75 0.71
76 0.72
77 0.75
78 0.77
79 0.82
80 0.82
81 0.78
82 0.75
83 0.78
84 0.77
85 0.75
86 0.7
87 0.63
88 0.54
89 0.48
90 0.42
91 0.33
92 0.26
93 0.18
94 0.14
95 0.12
96 0.14
97 0.14
98 0.14
99 0.14
100 0.11
101 0.11
102 0.1
103 0.1