Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409W9U0

Protein Details
Accession A0A409W9U0   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MPQTTEKTRKPRPKPAPYARKEKKAHVKDTPRTSSHydrophilic
86-105STLSRKIKRRHELEGRVNSHHydrophilic
NLS Segment(s)
PositionSequence
7-32KTRKPRPKPAPYARKEKKAHVKDTPR
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MPQTTEKTRKPRPKPAPYARKEKKAHVKDTPRTSSKPAAAGRHENLTLADWISVFKFIDSHPLLSQGDVVTHFKNKKDGALYFDQSTLSRKIKRRHELEGRVNSHPNALSSKRMRVVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.92
4 0.88
5 0.9
6 0.87
7 0.86
8 0.79
9 0.78
10 0.78
11 0.76
12 0.77
13 0.76
14 0.78
15 0.76
16 0.82
17 0.8
18 0.74
19 0.68
20 0.65
21 0.61
22 0.53
23 0.51
24 0.46
25 0.43
26 0.43
27 0.45
28 0.42
29 0.39
30 0.36
31 0.3
32 0.25
33 0.21
34 0.17
35 0.12
36 0.1
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.05
43 0.06
44 0.05
45 0.13
46 0.13
47 0.15
48 0.14
49 0.17
50 0.17
51 0.16
52 0.17
53 0.09
54 0.09
55 0.09
56 0.11
57 0.1
58 0.15
59 0.17
60 0.17
61 0.22
62 0.22
63 0.24
64 0.27
65 0.27
66 0.28
67 0.32
68 0.33
69 0.3
70 0.3
71 0.27
72 0.23
73 0.25
74 0.25
75 0.25
76 0.3
77 0.36
78 0.45
79 0.54
80 0.63
81 0.65
82 0.7
83 0.75
84 0.77
85 0.8
86 0.81
87 0.76
88 0.71
89 0.69
90 0.59
91 0.52
92 0.43
93 0.35
94 0.31
95 0.29
96 0.34
97 0.35
98 0.42