Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1VWW0

Protein Details
Accession K1VWW0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
53-78VNPIARARRRNPPQPRRLPLRPPVLLHydrophilic
NLS Segment(s)
PositionSequence
59-69ARRRNPPQPRR
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, cysk 3, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MSLPNSHIEEAQAGVNIPGDDMVPEPVRIAFPPIPESYEVVPELGAWSDPPTVNPIARARRRNPPQPRRLPLRPPVLLGSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.08
5 0.07
6 0.06
7 0.06
8 0.07
9 0.09
10 0.09
11 0.09
12 0.09
13 0.1
14 0.1
15 0.1
16 0.14
17 0.13
18 0.13
19 0.17
20 0.17
21 0.18
22 0.18
23 0.19
24 0.15
25 0.15
26 0.14
27 0.1
28 0.1
29 0.08
30 0.08
31 0.06
32 0.05
33 0.04
34 0.05
35 0.07
36 0.07
37 0.07
38 0.1
39 0.12
40 0.12
41 0.16
42 0.21
43 0.29
44 0.37
45 0.44
46 0.46
47 0.55
48 0.63
49 0.7
50 0.75
51 0.76
52 0.8
53 0.83
54 0.87
55 0.85
56 0.86
57 0.84
58 0.82
59 0.81
60 0.72
61 0.65