Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AQ82

Protein Details
Accession A0A437AQ82   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-48ESMSTKPPCPPKLKKKKPCKNCSCGRKEGTHydrophilic
NLS Segment(s)
PositionSequence
32-34KKK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.333, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007785  Anamorsin  
IPR046408  CIAPIN1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF05093  CIAPIN1  
Amino Acid Sequences MENENISEKEKNLEEKLKESMSTKPPCPPKLKKKKPCKNCSCGRKEGTSEPYKSKCGGCYLGDDYRCESCPYRGLPAFKPGEEVNFNMEDDKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.42
4 0.39
5 0.37
6 0.33
7 0.35
8 0.37
9 0.4
10 0.38
11 0.41
12 0.48
13 0.52
14 0.6
15 0.62
16 0.65
17 0.71
18 0.8
19 0.83
20 0.86
21 0.9
22 0.93
23 0.93
24 0.92
25 0.9
26 0.88
27 0.88
28 0.84
29 0.81
30 0.73
31 0.66
32 0.58
33 0.55
34 0.52
35 0.47
36 0.43
37 0.4
38 0.4
39 0.38
40 0.36
41 0.32
42 0.26
43 0.25
44 0.25
45 0.2
46 0.22
47 0.25
48 0.28
49 0.28
50 0.27
51 0.26
52 0.25
53 0.26
54 0.24
55 0.22
56 0.19
57 0.23
58 0.24
59 0.29
60 0.32
61 0.35
62 0.35
63 0.42
64 0.43
65 0.38
66 0.39
67 0.32
68 0.34
69 0.32
70 0.3
71 0.26
72 0.24
73 0.24
74 0.22