Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AP87

Protein Details
Accession A0A437AP87    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
95-114VKEVEKKPKKEKGVVKPTEKBasic
NLS Segment(s)
PositionSequence
60-72HKKGEKKVEKKVN
94-124EVKEVEKKPKKEKGVVKPTEKVSKAEQRKKF
Subcellular Location(s) cyto 12, cyto_nucl 11.333, nucl 8.5, mito_nucl 8.166, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MIKEGICIFSGYEVKKGSGLIKVTNDTRTFLFANRKVLALVTRKANPKDIKWTQPSRIYHKKGEKKVEKKVNQIKVVKEVRGFPGVSKDLVNKEVKEVEKKPKKEKGVVKPTEKVSKAEQRKKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.24
4 0.21
5 0.22
6 0.22
7 0.22
8 0.24
9 0.27
10 0.29
11 0.33
12 0.32
13 0.28
14 0.27
15 0.27
16 0.24
17 0.25
18 0.31
19 0.29
20 0.34
21 0.33
22 0.33
23 0.3
24 0.29
25 0.3
26 0.25
27 0.25
28 0.24
29 0.28
30 0.33
31 0.35
32 0.42
33 0.4
34 0.38
35 0.45
36 0.45
37 0.48
38 0.5
39 0.53
40 0.5
41 0.55
42 0.56
43 0.54
44 0.59
45 0.56
46 0.57
47 0.62
48 0.65
49 0.65
50 0.71
51 0.72
52 0.69
53 0.75
54 0.77
55 0.72
56 0.74
57 0.76
58 0.73
59 0.71
60 0.68
61 0.6
62 0.59
63 0.58
64 0.5
65 0.42
66 0.37
67 0.32
68 0.31
69 0.29
70 0.21
71 0.24
72 0.23
73 0.22
74 0.21
75 0.21
76 0.2
77 0.25
78 0.28
79 0.21
80 0.23
81 0.28
82 0.3
83 0.35
84 0.38
85 0.44
86 0.51
87 0.57
88 0.64
89 0.67
90 0.71
91 0.73
92 0.78
93 0.78
94 0.79
95 0.81
96 0.79
97 0.77
98 0.77
99 0.77
100 0.69
101 0.61
102 0.59
103 0.6
104 0.64