Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437ANM6

Protein Details
Accession A0A437ANM6    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPSLKKLKKKYFINLNKSFGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11.5, mito 6, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006984  Fcf1/Utp23  
Gene Ontology GO:0032040  C:small-subunit processome  
Pfam View protein in Pfam  
PF04900  Fcf1  
Amino Acid Sequences MPSLKKLKXXKKYFINLNKSFGFRSPYQLLIDSSFLTELNKYKHKLSSFKSFLKSEPKIFISKCSYRIYTYNHKLKDDFKKHCEIRRCNHNKLSEEECIGDLIKKDNKYHYILCTQNDSFIDKYIENDKVPVLKVFKSVIDFVEKNKISNQENEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.8
3 0.73
4 0.67
5 0.59
6 0.5
7 0.46
8 0.37
9 0.36
10 0.33
11 0.32
12 0.32
13 0.32
14 0.3
15 0.27
16 0.27
17 0.2
18 0.17
19 0.15
20 0.13
21 0.11
22 0.12
23 0.14
24 0.18
25 0.23
26 0.25
27 0.28
28 0.33
29 0.37
30 0.42
31 0.44
32 0.49
33 0.5
34 0.53
35 0.55
36 0.51
37 0.5
38 0.52
39 0.5
40 0.43
41 0.41
42 0.37
43 0.37
44 0.36
45 0.38
46 0.36
47 0.35
48 0.37
49 0.36
50 0.35
51 0.32
52 0.36
53 0.36
54 0.39
55 0.45
56 0.47
57 0.46
58 0.46
59 0.45
60 0.48
61 0.53
62 0.52
63 0.49
64 0.45
65 0.52
66 0.55
67 0.59
68 0.62
69 0.58
70 0.56
71 0.61
72 0.65
73 0.62
74 0.65
75 0.65
76 0.58
77 0.56
78 0.54
79 0.44
80 0.38
81 0.32
82 0.26
83 0.21
84 0.18
85 0.15
86 0.11
87 0.14
88 0.17
89 0.19
90 0.2
91 0.25
92 0.28
93 0.32
94 0.34
95 0.33
96 0.36
97 0.37
98 0.37
99 0.39
100 0.35
101 0.34
102 0.32
103 0.31
104 0.24
105 0.23
106 0.24
107 0.18
108 0.2
109 0.22
110 0.24
111 0.21
112 0.22
113 0.21
114 0.22
115 0.23
116 0.25
117 0.23
118 0.21
119 0.23
120 0.24
121 0.25
122 0.25
123 0.25
124 0.22
125 0.27
126 0.27
127 0.27
128 0.36
129 0.34
130 0.32
131 0.36
132 0.4
133 0.36