Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437ALY6

Protein Details
Accession A0A437ALY6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-39TASEKYTCKTCNKKNKFEKNKLKFIKIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012164  Rpa12/Rpb9/Rpc10/TFS  
IPR034004  Zn_ribbon_RPA12_C  
IPR001222  Znf_TFIIS  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
GO:0006379  P:mRNA cleavage  
Pfam View protein in Pfam  
PF01096  TFIIS_C  
PROSITE View protein in PROSITE  
PS51133  ZF_TFIIS_2  
CDD cd10507  Zn-ribbon_RPA12  
Amino Acid Sequences MFCSCGSVLLIPTASEKYTCKTCNKKNKFEKNKLKFIKIYDDPKEKCDEVVDPKIKRICENCGEKEMAFKSVQLRSADEGQTIFYSCNTCGFRITVHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.16
5 0.23
6 0.27
7 0.34
8 0.43
9 0.52
10 0.62
11 0.7
12 0.77
13 0.81
14 0.88
15 0.9
16 0.91
17 0.92
18 0.89
19 0.9
20 0.85
21 0.79
22 0.71
23 0.62
24 0.6
25 0.55
26 0.54
27 0.5
28 0.54
29 0.49
30 0.48
31 0.49
32 0.4
33 0.34
34 0.28
35 0.24
36 0.21
37 0.28
38 0.32
39 0.29
40 0.33
41 0.36
42 0.35
43 0.36
44 0.32
45 0.3
46 0.32
47 0.38
48 0.37
49 0.37
50 0.38
51 0.35
52 0.37
53 0.32
54 0.27
55 0.21
56 0.2
57 0.21
58 0.22
59 0.27
60 0.24
61 0.25
62 0.25
63 0.3
64 0.29
65 0.25
66 0.23
67 0.19
68 0.19
69 0.18
70 0.15
71 0.11
72 0.12
73 0.12
74 0.19
75 0.19
76 0.19
77 0.21
78 0.21