Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AIH5

Protein Details
Accession A0A437AIH5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-27EDSSVFKKLKNKLEKKNNEFYKEVHydrophilic
126-152GNKFENISKHKKRVRNKINEYRKENDSHydrophilic
NLS Segment(s)
PositionSequence
134-144KHKKRVRNKIN
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MKSEDSSVFKKLKNKLEKKNNEFYKEVNDELEKKFEERKSQLKTLIVNKTKELSDFINTNFDKINTLTKKNEDSYKELVHEYKLLSKKYDKFTEQYKSDSKEISSLKKKINSFISKEKEALQIELGNKFENISKHKKRVRNKINEYRKENDSKKIKGIIANLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.79
4 0.86
5 0.86
6 0.88
7 0.86
8 0.81
9 0.73
10 0.64
11 0.61
12 0.54
13 0.47
14 0.39
15 0.35
16 0.33
17 0.33
18 0.35
19 0.27
20 0.25
21 0.31
22 0.31
23 0.36
24 0.38
25 0.45
26 0.48
27 0.52
28 0.54
29 0.5
30 0.52
31 0.52
32 0.56
33 0.54
34 0.48
35 0.45
36 0.43
37 0.4
38 0.35
39 0.3
40 0.22
41 0.19
42 0.19
43 0.18
44 0.24
45 0.24
46 0.24
47 0.22
48 0.2
49 0.18
50 0.17
51 0.26
52 0.2
53 0.24
54 0.26
55 0.28
56 0.32
57 0.32
58 0.37
59 0.31
60 0.33
61 0.33
62 0.32
63 0.31
64 0.29
65 0.27
66 0.22
67 0.2
68 0.15
69 0.18
70 0.2
71 0.2
72 0.21
73 0.25
74 0.31
75 0.35
76 0.4
77 0.35
78 0.34
79 0.4
80 0.45
81 0.42
82 0.41
83 0.39
84 0.38
85 0.38
86 0.36
87 0.3
88 0.29
89 0.3
90 0.34
91 0.37
92 0.38
93 0.42
94 0.47
95 0.48
96 0.47
97 0.54
98 0.51
99 0.5
100 0.54
101 0.55
102 0.51
103 0.51
104 0.48
105 0.45
106 0.39
107 0.35
108 0.27
109 0.25
110 0.24
111 0.26
112 0.24
113 0.18
114 0.17
115 0.17
116 0.18
117 0.19
118 0.24
119 0.32
120 0.4
121 0.5
122 0.58
123 0.66
124 0.73
125 0.8
126 0.84
127 0.85
128 0.87
129 0.88
130 0.91
131 0.92
132 0.89
133 0.83
134 0.8
135 0.78
136 0.72
137 0.71
138 0.68
139 0.63
140 0.63
141 0.64
142 0.6
143 0.55