Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437AIB4

Protein Details
Accession A0A437AIB4    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-97ALENNFKRKIKPTKRLKDKKKGKLGGFDMBasic
NLS Segment(s)
PositionSequence
74-91FKRKIKPTKRLKDKKKGK
Subcellular Location(s) E.R. 6, nucl 4, mito 4, extr 4, mito_nucl 4, plas 3, pero 3
Family & Domain DBs
Amino Acid Sequences MFLFLMITLTIATNLVSKKLFGSSKRYVNPILVNQVEVNEHPSVQKRSLELFSDKLVKRINKPKLLPNALENNFKRKIKPTKRLKDKKKGKLGGFDMESDYSYSDSNCGHLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.12
5 0.13
6 0.19
7 0.23
8 0.23
9 0.31
10 0.35
11 0.43
12 0.46
13 0.48
14 0.44
15 0.43
16 0.44
17 0.39
18 0.38
19 0.3
20 0.28
21 0.25
22 0.24
23 0.21
24 0.17
25 0.17
26 0.11
27 0.11
28 0.11
29 0.16
30 0.18
31 0.19
32 0.21
33 0.19
34 0.22
35 0.23
36 0.25
37 0.22
38 0.2
39 0.2
40 0.26
41 0.25
42 0.25
43 0.28
44 0.27
45 0.32
46 0.4
47 0.46
48 0.45
49 0.48
50 0.52
51 0.57
52 0.59
53 0.53
54 0.48
55 0.5
56 0.45
57 0.51
58 0.45
59 0.42
60 0.44
61 0.44
62 0.42
63 0.41
64 0.5
65 0.52
66 0.61
67 0.66
68 0.71
69 0.82
70 0.91
71 0.92
72 0.92
73 0.93
74 0.93
75 0.92
76 0.9
77 0.83
78 0.82
79 0.76
80 0.73
81 0.64
82 0.55
83 0.46
84 0.38
85 0.34
86 0.25
87 0.21
88 0.14
89 0.13
90 0.12
91 0.11
92 0.11
93 0.13