Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AHY4

Protein Details
Accession A0A437AHY4   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKILNYKIYKANKKFKLNTNHLKEMTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, mito 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
Amino Acid Sequences MKILNYKIYKANKXKFKLNTNHLKEMTVVLNKLKGNSNTVSTALMLYQLYTLLPKYEKNKIISYTLCIXLSYKFNDKYXPLKDILTEITNFFGEXMQETLQTELVKSQEIYFLLFLNFEFEFYKIYDEFYVVANDFMLDKEIVQTGHIILNDSFYLPLFLVFKTESIIMSIYYMACNFTEQTECSLFLFIKSCMKNNNEIELCLNELTEFYIEELKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.84
4 0.84
5 0.85
6 0.83
7 0.83
8 0.73
9 0.66
10 0.58
11 0.5
12 0.45
13 0.38
14 0.31
15 0.24
16 0.28
17 0.28
18 0.29
19 0.32
20 0.28
21 0.29
22 0.3
23 0.31
24 0.28
25 0.28
26 0.26
27 0.2
28 0.19
29 0.14
30 0.13
31 0.1
32 0.08
33 0.07
34 0.07
35 0.06
36 0.07
37 0.07
38 0.08
39 0.09
40 0.13
41 0.18
42 0.26
43 0.31
44 0.35
45 0.39
46 0.39
47 0.42
48 0.39
49 0.38
50 0.34
51 0.3
52 0.26
53 0.22
54 0.2
55 0.2
56 0.21
57 0.24
58 0.22
59 0.22
60 0.3
61 0.31
62 0.34
63 0.35
64 0.38
65 0.32
66 0.32
67 0.31
68 0.26
69 0.26
70 0.23
71 0.19
72 0.13
73 0.13
74 0.11
75 0.11
76 0.08
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.08
85 0.08
86 0.09
87 0.08
88 0.08
89 0.08
90 0.07
91 0.08
92 0.08
93 0.09
94 0.08
95 0.08
96 0.08
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.08
105 0.09
106 0.11
107 0.08
108 0.09
109 0.09
110 0.09
111 0.09
112 0.09
113 0.1
114 0.08
115 0.08
116 0.07
117 0.07
118 0.06
119 0.06
120 0.06
121 0.05
122 0.05
123 0.06
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.09
130 0.09
131 0.1
132 0.09
133 0.11
134 0.1
135 0.1
136 0.1
137 0.07
138 0.08
139 0.06
140 0.08
141 0.07
142 0.07
143 0.09
144 0.09
145 0.09
146 0.09
147 0.1
148 0.09
149 0.09
150 0.1
151 0.08
152 0.08
153 0.09
154 0.08
155 0.08
156 0.08
157 0.08
158 0.08
159 0.09
160 0.09
161 0.1
162 0.12
163 0.12
164 0.16
165 0.17
166 0.18
167 0.17
168 0.18
169 0.17
170 0.16
171 0.17
172 0.15
173 0.21
174 0.22
175 0.25
176 0.3
177 0.34
178 0.41
179 0.42
180 0.5
181 0.43
182 0.42
183 0.42
184 0.37
185 0.36
186 0.28
187 0.24
188 0.15
189 0.13
190 0.14
191 0.11
192 0.1
193 0.09