Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437AJ37

Protein Details
Accession A0A437AJ37    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-34VTQEIKKSYSKNKPPKRNRIKLNYAQKKAHydrophilic
NLS Segment(s)
PositionSequence
16-25KNKPPKRNRI
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MKIIDVTQEIKKSYSKNKPPKRNRIKLNYAQKKALEMYFQHNKYPTYEIKMILEKEFLIPEKNIVIWFQNRRAKEKEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.61
4 0.7
5 0.8
6 0.87
7 0.92
8 0.93
9 0.92
10 0.91
11 0.9
12 0.89
13 0.87
14 0.88
15 0.87
16 0.79
17 0.73
18 0.64
19 0.56
20 0.48
21 0.39
22 0.3
23 0.21
24 0.24
25 0.28
26 0.29
27 0.28
28 0.28
29 0.28
30 0.27
31 0.3
32 0.25
33 0.23
34 0.24
35 0.24
36 0.25
37 0.28
38 0.28
39 0.24
40 0.23
41 0.17
42 0.16
43 0.17
44 0.15
45 0.14
46 0.13
47 0.13
48 0.14
49 0.14
50 0.13
51 0.13
52 0.16
53 0.21
54 0.27
55 0.35
56 0.41
57 0.43
58 0.49
59 0.53