Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AHY2

Protein Details
Accession A0A437AHY2   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-48LNPNKPFKKCCTPDTKKCTCCNDTNTKKRLKNNTMHydrophilic
168-189SENRKNRIRGEKRKEITKKFKEBasic
NLS Segment(s)
PositionSequence
174-189RKNRIRGEKRKEITKK
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MTVNNPSKFLDRFLNPNKPFKKCCTPDXTKKCTCCNDTNTKKRLKNNTMIQSANXKDKVLNFISDSLSNMIYCSFKYQTERKEEYLNKMLIXKKNLFQLFKYISLRCVEPKKMNKKVEMHLNKYRDSLFDLKKDLEGFKMACSIPNLDDQQIMKISQDLYINGLGLCMVGSENRKNRIRGEKRKEITKKFKEILDNCYKKDLKIPTGNKKVLNSTDKFATLKKREESLKLISKYGEQNDNRMFLPRKLLAVKDLSNNNQENISFTKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.64
4 0.68
5 0.68
6 0.69
7 0.68
8 0.7
9 0.65
10 0.7
11 0.71
12 0.74
13 0.77
14 0.82
15 0.84
16 0.8
17 0.82
18 0.82
19 0.77
20 0.74
21 0.72
22 0.73
23 0.74
24 0.76
25 0.77
26 0.78
27 0.78
28 0.8
29 0.82
30 0.8
31 0.79
32 0.78
33 0.79
34 0.75
35 0.71
36 0.65
37 0.62
38 0.59
39 0.53
40 0.44
41 0.36
42 0.3
43 0.34
44 0.33
45 0.26
46 0.22
47 0.21
48 0.21
49 0.21
50 0.22
51 0.17
52 0.15
53 0.14
54 0.12
55 0.11
56 0.1
57 0.1
58 0.12
59 0.12
60 0.14
61 0.2
62 0.26
63 0.32
64 0.41
65 0.45
66 0.43
67 0.5
68 0.51
69 0.53
70 0.54
71 0.49
72 0.43
73 0.45
74 0.46
75 0.42
76 0.42
77 0.37
78 0.38
79 0.42
80 0.4
81 0.35
82 0.37
83 0.34
84 0.37
85 0.37
86 0.31
87 0.25
88 0.26
89 0.27
90 0.26
91 0.29
92 0.28
93 0.33
94 0.42
95 0.5
96 0.57
97 0.6
98 0.61
99 0.61
100 0.61
101 0.64
102 0.62
103 0.59
104 0.57
105 0.56
106 0.51
107 0.47
108 0.43
109 0.33
110 0.29
111 0.29
112 0.25
113 0.24
114 0.25
115 0.24
116 0.25
117 0.25
118 0.22
119 0.15
120 0.14
121 0.12
122 0.1
123 0.13
124 0.12
125 0.12
126 0.12
127 0.13
128 0.12
129 0.15
130 0.16
131 0.13
132 0.15
133 0.14
134 0.15
135 0.15
136 0.14
137 0.1
138 0.1
139 0.1
140 0.1
141 0.11
142 0.1
143 0.1
144 0.1
145 0.11
146 0.09
147 0.09
148 0.06
149 0.05
150 0.05
151 0.03
152 0.03
153 0.05
154 0.08
155 0.14
156 0.19
157 0.26
158 0.3
159 0.32
160 0.38
161 0.48
162 0.56
163 0.61
164 0.66
165 0.69
166 0.7
167 0.78
168 0.81
169 0.8
170 0.8
171 0.78
172 0.77
173 0.7
174 0.7
175 0.69
176 0.63
177 0.62
178 0.62
179 0.58
180 0.5
181 0.56
182 0.52
183 0.43
184 0.47
185 0.44
186 0.41
187 0.46
188 0.54
189 0.56
190 0.65
191 0.69
192 0.65
193 0.62
194 0.6
195 0.58
196 0.56
197 0.48
198 0.42
199 0.41
200 0.4
201 0.39
202 0.37
203 0.4
204 0.38
205 0.43
206 0.43
207 0.46
208 0.48
209 0.52
210 0.53
211 0.52
212 0.55
213 0.5
214 0.48
215 0.43
216 0.43
217 0.45
218 0.45
219 0.45
220 0.37
221 0.43
222 0.44
223 0.46
224 0.42
225 0.43
226 0.41
227 0.34
228 0.41
229 0.35
230 0.37
231 0.38
232 0.39
233 0.36
234 0.39
235 0.4
236 0.39
237 0.44
238 0.44
239 0.48
240 0.48
241 0.44
242 0.41
243 0.37
244 0.34