Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AP97

Protein Details
Accession A0A437AP97    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-67SKFINFLKRKEKKIQTVERKSVYKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 13, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031515  DUF5095  
Pfam View protein in Pfam  
PF17016  DUF5095  
Amino Acid Sequences MHEQNKNINFTSTITDNPFDLQPKKIDLILKPRTIKPDIKIDDSKFINFLKRKEKKIQTVERKSVYKKILVLSETNLEIEEKIYFKFPFSPQIKKENNFYFQEIYNHFXKAFDSVIFNYKNKKEYFYILINKEIFYFGDKIKVSKGLKDILKVNDIKFIERENELVIERNELIFVVDFIMNLPFDDNFVIPFILPKHQFENSIFYHSKVIRMPMVHCKNVVKYSYELEGYFFGEDYKELFNYEVKVYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.24
4 0.25
5 0.26
6 0.27
7 0.27
8 0.27
9 0.26
10 0.29
11 0.3
12 0.31
13 0.34
14 0.34
15 0.42
16 0.46
17 0.51
18 0.52
19 0.54
20 0.57
21 0.57
22 0.57
23 0.51
24 0.54
25 0.5
26 0.53
27 0.56
28 0.52
29 0.54
30 0.51
31 0.48
32 0.4
33 0.37
34 0.39
35 0.36
36 0.39
37 0.43
38 0.48
39 0.54
40 0.62
41 0.69
42 0.7
43 0.77
44 0.81
45 0.82
46 0.84
47 0.85
48 0.81
49 0.78
50 0.71
51 0.68
52 0.6
53 0.53
54 0.45
55 0.41
56 0.39
57 0.34
58 0.32
59 0.27
60 0.26
61 0.23
62 0.2
63 0.17
64 0.13
65 0.11
66 0.1
67 0.09
68 0.08
69 0.08
70 0.1
71 0.1
72 0.11
73 0.15
74 0.16
75 0.25
76 0.28
77 0.35
78 0.36
79 0.46
80 0.51
81 0.48
82 0.55
83 0.5
84 0.52
85 0.46
86 0.45
87 0.37
88 0.32
89 0.34
90 0.29
91 0.28
92 0.25
93 0.23
94 0.21
95 0.18
96 0.18
97 0.15
98 0.14
99 0.12
100 0.12
101 0.15
102 0.17
103 0.18
104 0.23
105 0.24
106 0.27
107 0.24
108 0.27
109 0.24
110 0.25
111 0.29
112 0.3
113 0.34
114 0.31
115 0.34
116 0.31
117 0.3
118 0.27
119 0.23
120 0.17
121 0.13
122 0.13
123 0.09
124 0.15
125 0.15
126 0.15
127 0.16
128 0.23
129 0.21
130 0.23
131 0.25
132 0.25
133 0.27
134 0.29
135 0.33
136 0.28
137 0.33
138 0.31
139 0.29
140 0.29
141 0.29
142 0.27
143 0.23
144 0.22
145 0.19
146 0.18
147 0.18
148 0.12
149 0.14
150 0.13
151 0.15
152 0.14
153 0.13
154 0.13
155 0.12
156 0.11
157 0.1
158 0.1
159 0.07
160 0.07
161 0.07
162 0.06
163 0.06
164 0.07
165 0.08
166 0.07
167 0.07
168 0.08
169 0.06
170 0.06
171 0.07
172 0.07
173 0.07
174 0.08
175 0.08
176 0.07
177 0.09
178 0.1
179 0.16
180 0.17
181 0.19
182 0.23
183 0.24
184 0.28
185 0.27
186 0.32
187 0.28
188 0.34
189 0.32
190 0.29
191 0.34
192 0.31
193 0.33
194 0.29
195 0.31
196 0.27
197 0.29
198 0.31
199 0.36
200 0.42
201 0.4
202 0.41
203 0.42
204 0.43
205 0.47
206 0.45
207 0.37
208 0.33
209 0.34
210 0.35
211 0.33
212 0.28
213 0.24
214 0.23
215 0.21
216 0.19
217 0.15
218 0.12
219 0.11
220 0.11
221 0.11
222 0.13
223 0.12
224 0.12
225 0.13
226 0.15
227 0.18