Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AHF9

Protein Details
Accession A0A437AHF9   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
168-188DYSKHIPKRKWLNFRELIRFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR015757  Calcineur_B  
IPR011992  EF-hand-dom_pair  
IPR002048  EF_hand_dom  
Gene Ontology GO:0005509  F:calcium ion binding  
GO:0008597  F:calcium-dependent protein serine/threonine phosphatase regulator activity  
Pfam View protein in Pfam  
PF13833  EF-hand_8  
PROSITE View protein in PROSITE  
PS50222  EF_HAND_2  
Amino Acid Sequences MGNTTSDLTNDEIEDLTTWTTFTPKEIEVIFDRFNELDIRNNGYLSFTELMRLPEFHSNPLAPLFIREIERIVDYNNISFPHFLEILEIFSVRKDAKHRILFLFKVFDLNNENRLCKHVLRKIAFMIGSTDFYSVLKDYDLENKGYLNYKDFTKFYYNENVDEVLAFDYSKHIPKRKWLNFRELIRFLFGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.09
5 0.09
6 0.08
7 0.1
8 0.1
9 0.11
10 0.13
11 0.13
12 0.16
13 0.16
14 0.19
15 0.21
16 0.25
17 0.25
18 0.21
19 0.23
20 0.2
21 0.21
22 0.2
23 0.17
24 0.2
25 0.21
26 0.26
27 0.25
28 0.25
29 0.24
30 0.22
31 0.21
32 0.18
33 0.17
34 0.11
35 0.12
36 0.14
37 0.16
38 0.16
39 0.16
40 0.14
41 0.21
42 0.22
43 0.22
44 0.23
45 0.21
46 0.21
47 0.21
48 0.2
49 0.12
50 0.12
51 0.12
52 0.12
53 0.13
54 0.12
55 0.13
56 0.13
57 0.14
58 0.13
59 0.12
60 0.13
61 0.11
62 0.12
63 0.12
64 0.12
65 0.12
66 0.12
67 0.11
68 0.11
69 0.11
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.06
77 0.06
78 0.07
79 0.06
80 0.08
81 0.11
82 0.16
83 0.24
84 0.28
85 0.3
86 0.32
87 0.36
88 0.35
89 0.33
90 0.3
91 0.22
92 0.21
93 0.19
94 0.17
95 0.18
96 0.18
97 0.23
98 0.22
99 0.23
100 0.2
101 0.23
102 0.24
103 0.22
104 0.29
105 0.28
106 0.35
107 0.37
108 0.38
109 0.37
110 0.38
111 0.34
112 0.27
113 0.24
114 0.17
115 0.16
116 0.14
117 0.13
118 0.11
119 0.11
120 0.11
121 0.09
122 0.08
123 0.07
124 0.07
125 0.08
126 0.16
127 0.18
128 0.18
129 0.18
130 0.18
131 0.19
132 0.24
133 0.24
134 0.19
135 0.19
136 0.21
137 0.25
138 0.25
139 0.27
140 0.28
141 0.29
142 0.29
143 0.37
144 0.36
145 0.34
146 0.35
147 0.32
148 0.26
149 0.25
150 0.22
151 0.13
152 0.11
153 0.09
154 0.07
155 0.1
156 0.12
157 0.19
158 0.26
159 0.32
160 0.35
161 0.45
162 0.57
163 0.64
164 0.72
165 0.71
166 0.74
167 0.76
168 0.81
169 0.8
170 0.73
171 0.65