Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437ANN3

Protein Details
Accession A0A437ANN3   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
64-86LMYFLKRDKKKYNRVKELLKISEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 11.833, mito_nucl 11.833, mito 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0003743  F:translation initiation factor activity  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MREKKKLSFLKEISMMMYGYGDVRIPRHDTTQTVHDYMIGYMKGLLVKTHNMAKNKGKTKTDDLMYFLKRDKKKYNRVKELLKISEEVKIARKLYDFERFEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.32
3 0.21
4 0.19
5 0.12
6 0.08
7 0.08
8 0.08
9 0.07
10 0.09
11 0.11
12 0.15
13 0.16
14 0.2
15 0.21
16 0.22
17 0.25
18 0.29
19 0.3
20 0.27
21 0.25
22 0.22
23 0.21
24 0.19
25 0.18
26 0.12
27 0.09
28 0.08
29 0.08
30 0.08
31 0.08
32 0.08
33 0.07
34 0.08
35 0.1
36 0.16
37 0.19
38 0.21
39 0.25
40 0.32
41 0.39
42 0.44
43 0.48
44 0.45
45 0.45
46 0.49
47 0.5
48 0.47
49 0.4
50 0.36
51 0.37
52 0.36
53 0.34
54 0.31
55 0.34
56 0.35
57 0.4
58 0.47
59 0.51
60 0.61
61 0.7
62 0.77
63 0.8
64 0.83
65 0.84
66 0.82
67 0.81
68 0.75
69 0.66
70 0.56
71 0.46
72 0.44
73 0.37
74 0.32
75 0.28
76 0.29
77 0.28
78 0.28
79 0.29
80 0.27
81 0.32
82 0.4
83 0.38