Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437ANU1

Protein Details
Accession A0A437ANU1   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
247-275KRWFTRPGEKLPKQRWNKKMKLKFLRSYYHydrophilic
NLS Segment(s)
PositionSequence
256-270EKLPKQRWNKKMKLK
Subcellular Location(s) mito 14, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF01633  Choline_kinase  
Amino Acid Sequences MFYYFAFALMNNLSTINCTQALRGSISVPNDNEETRSFNFAEAKDYIEKNYNSQLVKLSETNNVVFKFVVNNKEYVIKQFSHSNGNTENKFAKIIGFPKVIYCGTDFRIEEFVNFKKIDYIADLEKIAVSLRXLHRMPVVQSLSFLPRYDLMLNYFYWSFIDSLKIIESEKTASFKKLKESKCLFKKIHRRVCQLIVKNRLGFDKICHNDLNFNNIWKVGNNIKFIDYEFVSLNDPLLDIARFFYLTKRWFTRPGEKLPKQRWNKKMKLKFLRSYYGKDVKKSFLKNKLKVINSIGVITNYFYFLHNLFIISSDLSQDISVRVRRLKNHLGILKKEEFISYEEHCKVTKIIIFLENESKNIRKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.16
5 0.15
6 0.16
7 0.19
8 0.22
9 0.22
10 0.22
11 0.22
12 0.23
13 0.26
14 0.31
15 0.27
16 0.28
17 0.28
18 0.28
19 0.27
20 0.25
21 0.27
22 0.24
23 0.27
24 0.25
25 0.25
26 0.29
27 0.27
28 0.3
29 0.25
30 0.28
31 0.28
32 0.29
33 0.29
34 0.32
35 0.32
36 0.31
37 0.36
38 0.38
39 0.33
40 0.34
41 0.36
42 0.31
43 0.33
44 0.33
45 0.29
46 0.29
47 0.31
48 0.31
49 0.3
50 0.29
51 0.26
52 0.23
53 0.21
54 0.23
55 0.25
56 0.3
57 0.27
58 0.27
59 0.28
60 0.34
61 0.34
62 0.32
63 0.31
64 0.25
65 0.26
66 0.31
67 0.32
68 0.34
69 0.34
70 0.33
71 0.36
72 0.41
73 0.39
74 0.37
75 0.37
76 0.29
77 0.3
78 0.26
79 0.21
80 0.19
81 0.22
82 0.24
83 0.23
84 0.23
85 0.23
86 0.26
87 0.24
88 0.2
89 0.19
90 0.16
91 0.17
92 0.22
93 0.21
94 0.19
95 0.23
96 0.22
97 0.21
98 0.22
99 0.22
100 0.22
101 0.22
102 0.2
103 0.18
104 0.19
105 0.18
106 0.16
107 0.17
108 0.14
109 0.16
110 0.16
111 0.13
112 0.13
113 0.12
114 0.1
115 0.1
116 0.08
117 0.11
118 0.16
119 0.18
120 0.18
121 0.19
122 0.2
123 0.19
124 0.24
125 0.23
126 0.18
127 0.17
128 0.19
129 0.21
130 0.2
131 0.19
132 0.15
133 0.12
134 0.14
135 0.14
136 0.13
137 0.13
138 0.13
139 0.13
140 0.14
141 0.13
142 0.11
143 0.1
144 0.1
145 0.09
146 0.07
147 0.09
148 0.07
149 0.08
150 0.08
151 0.09
152 0.08
153 0.08
154 0.08
155 0.09
156 0.1
157 0.12
158 0.12
159 0.16
160 0.19
161 0.2
162 0.28
163 0.34
164 0.36
165 0.43
166 0.48
167 0.54
168 0.58
169 0.65
170 0.59
171 0.59
172 0.68
173 0.69
174 0.73
175 0.71
176 0.69
177 0.64
178 0.7
179 0.69
180 0.65
181 0.62
182 0.6
183 0.55
184 0.51
185 0.48
186 0.4
187 0.34
188 0.28
189 0.22
190 0.24
191 0.23
192 0.24
193 0.24
194 0.23
195 0.28
196 0.28
197 0.33
198 0.23
199 0.23
200 0.21
201 0.21
202 0.21
203 0.14
204 0.17
205 0.18
206 0.22
207 0.23
208 0.23
209 0.24
210 0.24
211 0.24
212 0.23
213 0.17
214 0.14
215 0.12
216 0.12
217 0.12
218 0.12
219 0.11
220 0.09
221 0.08
222 0.07
223 0.07
224 0.06
225 0.05
226 0.06
227 0.06
228 0.07
229 0.07
230 0.09
231 0.14
232 0.17
233 0.23
234 0.26
235 0.29
236 0.36
237 0.42
238 0.5
239 0.51
240 0.58
241 0.64
242 0.67
243 0.73
244 0.75
245 0.79
246 0.8
247 0.83
248 0.82
249 0.82
250 0.84
251 0.85
252 0.85
253 0.86
254 0.87
255 0.86
256 0.84
257 0.8
258 0.8
259 0.72
260 0.69
261 0.67
262 0.66
263 0.6
264 0.57
265 0.55
266 0.52
267 0.56
268 0.59
269 0.58
270 0.6
271 0.67
272 0.68
273 0.74
274 0.75
275 0.7
276 0.66
277 0.62
278 0.56
279 0.47
280 0.43
281 0.35
282 0.27
283 0.25
284 0.21
285 0.17
286 0.13
287 0.12
288 0.11
289 0.12
290 0.12
291 0.14
292 0.13
293 0.13
294 0.12
295 0.13
296 0.13
297 0.12
298 0.11
299 0.1
300 0.1
301 0.1
302 0.1
303 0.09
304 0.1
305 0.15
306 0.19
307 0.22
308 0.29
309 0.34
310 0.4
311 0.48
312 0.55
313 0.56
314 0.62
315 0.64
316 0.64
317 0.64
318 0.66
319 0.62
320 0.54
321 0.48
322 0.4
323 0.35
324 0.29
325 0.29
326 0.25
327 0.28
328 0.29
329 0.3
330 0.29
331 0.29
332 0.28
333 0.29
334 0.28
335 0.23
336 0.25
337 0.28
338 0.3
339 0.32
340 0.4
341 0.36
342 0.35
343 0.37