Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437ANW4

Protein Details
Accession A0A437ANW4   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRSREGRRGRRSTVRSNRTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0016874  F:ligase activity  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
CDD cd16473  RING-H2_RNF103  
Amino Acid Sequences MRSREGRRGRRSTVRSNRTSNSNRRNQSXEPDTNEPNLNSAYYDLLDSFTDSLIAGRNSGLLGSILYSHPEDTFRRRRELTFNVVFDLFDNISNRLRLIAYSDPSSMQNINGFFTFIINEPFKFTNKTLKKEEVDKLKKERYNSKEKKDCPICYLSFKKNDFIRNLDCKHIFHTKCIDPWLLSGSDKCPMCRKEVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.79
4 0.75
5 0.74
6 0.76
7 0.76
8 0.75
9 0.75
10 0.74
11 0.72
12 0.72
13 0.67
14 0.67
15 0.66
16 0.61
17 0.59
18 0.58
19 0.54
20 0.52
21 0.47
22 0.4
23 0.31
24 0.26
25 0.18
26 0.13
27 0.13
28 0.1
29 0.11
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.08
36 0.07
37 0.07
38 0.07
39 0.09
40 0.08
41 0.08
42 0.07
43 0.08
44 0.08
45 0.07
46 0.07
47 0.05
48 0.04
49 0.04
50 0.06
51 0.05
52 0.07
53 0.08
54 0.08
55 0.08
56 0.11
57 0.13
58 0.2
59 0.3
60 0.31
61 0.37
62 0.38
63 0.4
64 0.45
65 0.48
66 0.47
67 0.43
68 0.41
69 0.36
70 0.35
71 0.32
72 0.25
73 0.22
74 0.14
75 0.1
76 0.11
77 0.11
78 0.12
79 0.12
80 0.12
81 0.1
82 0.1
83 0.08
84 0.11
85 0.12
86 0.12
87 0.13
88 0.14
89 0.14
90 0.15
91 0.16
92 0.13
93 0.11
94 0.11
95 0.1
96 0.11
97 0.1
98 0.1
99 0.08
100 0.08
101 0.09
102 0.07
103 0.1
104 0.1
105 0.1
106 0.13
107 0.14
108 0.15
109 0.18
110 0.19
111 0.26
112 0.31
113 0.37
114 0.39
115 0.45
116 0.46
117 0.5
118 0.55
119 0.55
120 0.57
121 0.57
122 0.6
123 0.62
124 0.62
125 0.61
126 0.64
127 0.61
128 0.65
129 0.67
130 0.7
131 0.71
132 0.71
133 0.77
134 0.75
135 0.71
136 0.64
137 0.62
138 0.54
139 0.53
140 0.58
141 0.54
142 0.54
143 0.53
144 0.54
145 0.53
146 0.57
147 0.52
148 0.51
149 0.52
150 0.53
151 0.54
152 0.55
153 0.52
154 0.46
155 0.47
156 0.51
157 0.44
158 0.4
159 0.46
160 0.42
161 0.43
162 0.46
163 0.43
164 0.34
165 0.35
166 0.33
167 0.27
168 0.25
169 0.23
170 0.22
171 0.26
172 0.27
173 0.28
174 0.33
175 0.33