Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437AQU2

Protein Details
Accession A0A437AQU2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
101-129GATNCRKRKCGHSSKLRPKKQAKEGKKGKBasic
NLS Segment(s)
PositionSequence
107-129KRKCGHSSKLRPKKQAKEGKKGK
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 6, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
Amino Acid Sequences MNIFIKLSNSLSQINCSQEETPTQLLRRLGYTNKFRLSGHTTLINSVPLCKQINNYSTITLLPVLAGGAGDKKLNENDRALALARKQAMICRCCYARLAPGATNCRKRKCGHSSKLRPKKQAKEGKKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.28
4 0.26
5 0.23
6 0.24
7 0.25
8 0.26
9 0.26
10 0.26
11 0.28
12 0.29
13 0.28
14 0.28
15 0.27
16 0.29
17 0.33
18 0.4
19 0.42
20 0.43
21 0.44
22 0.41
23 0.43
24 0.44
25 0.38
26 0.32
27 0.31
28 0.28
29 0.28
30 0.28
31 0.25
32 0.18
33 0.18
34 0.16
35 0.15
36 0.15
37 0.14
38 0.17
39 0.2
40 0.22
41 0.24
42 0.24
43 0.21
44 0.21
45 0.2
46 0.18
47 0.12
48 0.1
49 0.06
50 0.05
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.04
59 0.06
60 0.09
61 0.12
62 0.14
63 0.14
64 0.15
65 0.15
66 0.16
67 0.16
68 0.15
69 0.13
70 0.15
71 0.15
72 0.15
73 0.15
74 0.18
75 0.24
76 0.24
77 0.26
78 0.26
79 0.26
80 0.26
81 0.28
82 0.26
83 0.24
84 0.27
85 0.28
86 0.26
87 0.32
88 0.4
89 0.46
90 0.54
91 0.56
92 0.58
93 0.6
94 0.61
95 0.64
96 0.66
97 0.7
98 0.7
99 0.75
100 0.8
101 0.86
102 0.93
103 0.92
104 0.91
105 0.9
106 0.9
107 0.89
108 0.89
109 0.87