Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437ANY3

Protein Details
Accession A0A437ANY3    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MKFNKNISSSRRKQRKAHFTANPSERRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 13, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005825  Ribosomal_L24/26_CS  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS01108  RIBOSOMAL_L24  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MKFNKNISSSRRKQRKAHFTANPSERRIRMSSTLSKELRTKYGFRSFPIRTNDKVTVIAGKFKNKSGTVVQVRRKDYKVYVDCCEGLRRNGKKKYIGIDASNLRIDEFYMEEGRDKIIEKKMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.85
4 0.86
5 0.84
6 0.79
7 0.81
8 0.81
9 0.76
10 0.7
11 0.67
12 0.57
13 0.53
14 0.49
15 0.43
16 0.39
17 0.4
18 0.43
19 0.44
20 0.51
21 0.47
22 0.47
23 0.47
24 0.45
25 0.44
26 0.39
27 0.36
28 0.34
29 0.43
30 0.41
31 0.39
32 0.44
33 0.4
34 0.44
35 0.48
36 0.44
37 0.37
38 0.42
39 0.42
40 0.35
41 0.34
42 0.27
43 0.25
44 0.22
45 0.26
46 0.22
47 0.25
48 0.25
49 0.26
50 0.29
51 0.24
52 0.27
53 0.22
54 0.29
55 0.33
56 0.39
57 0.45
58 0.48
59 0.52
60 0.53
61 0.53
62 0.47
63 0.42
64 0.44
65 0.44
66 0.41
67 0.4
68 0.38
69 0.38
70 0.36
71 0.38
72 0.3
73 0.29
74 0.34
75 0.39
76 0.46
77 0.52
78 0.57
79 0.58
80 0.61
81 0.61
82 0.6
83 0.57
84 0.5
85 0.5
86 0.47
87 0.44
88 0.41
89 0.36
90 0.27
91 0.23
92 0.21
93 0.15
94 0.13
95 0.13
96 0.13
97 0.13
98 0.15
99 0.15
100 0.16
101 0.16
102 0.17
103 0.2