Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AK55

Protein Details
Accession A0A437AK55   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
143-162KKEETKEEEKEIKKKKKKEDBasic
NLS Segment(s)
PositionSequence
148-161KEEEKEIKKKKKKE
Subcellular Location(s) plas 6, E.R. 5, nucl 4, cyto 4, cyto_nucl 4, pero 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012098  SND3_fun  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0045047  P:protein targeting to ER  
Pfam View protein in Pfam  
PF10032  Pho88  
Amino Acid Sequences MQSLKKIPIMEGNVIWIIRGVFIASIALQAYLLFFIKRKISLTNDTRTVSVPKISGEEEGNEDITFSEYDKRECDKLIKGIAIQLAITLFIHVKWNVIQPLIIQAITPIKSFFLKPLYCIYLRNFDMIRPYENNLLFSKTAEKKEETKEEEKEIKKKKKKED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.18
4 0.14
5 0.1
6 0.1
7 0.08
8 0.05
9 0.06
10 0.06
11 0.05
12 0.06
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.06
21 0.06
22 0.09
23 0.12
24 0.14
25 0.15
26 0.18
27 0.23
28 0.32
29 0.37
30 0.41
31 0.43
32 0.42
33 0.42
34 0.39
35 0.36
36 0.29
37 0.25
38 0.19
39 0.16
40 0.16
41 0.16
42 0.16
43 0.14
44 0.14
45 0.14
46 0.14
47 0.14
48 0.12
49 0.11
50 0.09
51 0.1
52 0.09
53 0.07
54 0.11
55 0.12
56 0.13
57 0.15
58 0.17
59 0.17
60 0.18
61 0.21
62 0.18
63 0.21
64 0.21
65 0.2
66 0.17
67 0.18
68 0.17
69 0.14
70 0.11
71 0.08
72 0.06
73 0.06
74 0.05
75 0.04
76 0.04
77 0.04
78 0.07
79 0.06
80 0.07
81 0.08
82 0.11
83 0.12
84 0.12
85 0.12
86 0.09
87 0.13
88 0.13
89 0.12
90 0.09
91 0.09
92 0.12
93 0.13
94 0.13
95 0.1
96 0.1
97 0.11
98 0.12
99 0.14
100 0.18
101 0.17
102 0.19
103 0.23
104 0.26
105 0.26
106 0.28
107 0.29
108 0.3
109 0.3
110 0.32
111 0.28
112 0.24
113 0.3
114 0.3
115 0.31
116 0.25
117 0.28
118 0.31
119 0.32
120 0.34
121 0.28
122 0.3
123 0.26
124 0.25
125 0.3
126 0.3
127 0.34
128 0.35
129 0.37
130 0.4
131 0.48
132 0.56
133 0.55
134 0.56
135 0.55
136 0.59
137 0.65
138 0.66
139 0.67
140 0.69
141 0.72
142 0.75