Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437ALL2

Protein Details
Accession A0A437ALL2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-34DEIFAKYRKRRINDFKKQKEVKELKBasic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Pfam View protein in Pfam  
PF00085  Thioredoxin  
Amino Acid Sequences MTDTSDFSDDEIFAKYRKRRINDFKKQKEVKELKTEEELMKKSMSDTMIVHFYKEEFLRCKIMNEALERVCHKFRDIDFYKAKAENCLVITEKLNIQALPFLGFFHKGFFVDYIVGFEKIGENELKEEELISFIKNSNIYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.35
4 0.43
5 0.48
6 0.56
7 0.66
8 0.75
9 0.79
10 0.84
11 0.85
12 0.88
13 0.88
14 0.81
15 0.81
16 0.78
17 0.74
18 0.73
19 0.66
20 0.58
21 0.55
22 0.55
23 0.47
24 0.45
25 0.39
26 0.3
27 0.28
28 0.25
29 0.21
30 0.21
31 0.18
32 0.14
33 0.13
34 0.13
35 0.19
36 0.19
37 0.18
38 0.16
39 0.15
40 0.16
41 0.16
42 0.17
43 0.14
44 0.16
45 0.2
46 0.2
47 0.21
48 0.2
49 0.22
50 0.22
51 0.21
52 0.22
53 0.19
54 0.21
55 0.21
56 0.22
57 0.2
58 0.18
59 0.17
60 0.17
61 0.17
62 0.25
63 0.27
64 0.31
65 0.32
66 0.34
67 0.37
68 0.36
69 0.35
70 0.28
71 0.26
72 0.21
73 0.18
74 0.18
75 0.17
76 0.15
77 0.16
78 0.15
79 0.15
80 0.15
81 0.15
82 0.13
83 0.11
84 0.12
85 0.11
86 0.11
87 0.1
88 0.09
89 0.1
90 0.12
91 0.12
92 0.12
93 0.13
94 0.11
95 0.12
96 0.12
97 0.13
98 0.12
99 0.12
100 0.13
101 0.14
102 0.14
103 0.13
104 0.12
105 0.13
106 0.12
107 0.15
108 0.12
109 0.11
110 0.13
111 0.14
112 0.15
113 0.13
114 0.13
115 0.11
116 0.12
117 0.12
118 0.11
119 0.12
120 0.12
121 0.16