Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437ALH6

Protein Details
Accession A0A437ALH6    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSKKNIIKNYCRKRRGKNTRITIPFNLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007590  Saf4/Yju2  
Gene Ontology GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF04502  Saf4_Yju2  
Amino Acid Sequences MSKKNIIKNYCRKRRGKNTRITIPFNLLCTECKYTLPKSKKIYVNRILSEETYLSVPIYLFEFPCYNCGKNIVFKTDPKAGDYKPFLNCKIVNNICENESFDKKINKSNLSIEELKEKELKNLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.9
4 0.89
5 0.89
6 0.89
7 0.88
8 0.83
9 0.74
10 0.7
11 0.61
12 0.52
13 0.44
14 0.34
15 0.29
16 0.27
17 0.28
18 0.22
19 0.23
20 0.25
21 0.29
22 0.38
23 0.42
24 0.46
25 0.48
26 0.55
27 0.61
28 0.65
29 0.69
30 0.67
31 0.68
32 0.62
33 0.59
34 0.52
35 0.44
36 0.38
37 0.28
38 0.2
39 0.13
40 0.11
41 0.08
42 0.07
43 0.07
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.08
50 0.08
51 0.11
52 0.13
53 0.12
54 0.12
55 0.15
56 0.15
57 0.2
58 0.22
59 0.25
60 0.25
61 0.26
62 0.3
63 0.33
64 0.33
65 0.29
66 0.31
67 0.26
68 0.31
69 0.33
70 0.33
71 0.32
72 0.36
73 0.35
74 0.37
75 0.38
76 0.34
77 0.4
78 0.38
79 0.35
80 0.36
81 0.36
82 0.32
83 0.31
84 0.31
85 0.26
86 0.27
87 0.27
88 0.28
89 0.34
90 0.35
91 0.42
92 0.46
93 0.44
94 0.44
95 0.48
96 0.49
97 0.48
98 0.49
99 0.43
100 0.45
101 0.42
102 0.41
103 0.4
104 0.36