Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AKU6

Protein Details
Accession A0A437AKU6   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTIPIRRPPPKKQVQEQTIMVHydrophilic
289-314EINNLKKNECKEKKVRERIDKILGKYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015425  FH2_Formin  
IPR042201  FH2_Formin_sf  
Pfam View protein in Pfam  
PF02181  FH2  
PROSITE View protein in PROSITE  
PS51444  FH2  
Amino Acid Sequences MTIPIRRPPPKKQVQEQTIMVKWIRLPLSTNSIFTKLPQLTIEIEDNELISYEKKAVQPKPKTETTFLLEIKKYNAINIAFSRINNTDEEIINEVMLNNSVNDNLIRVLYQYFPSEEEFMLIEEKINLLDTVELKNNEDLENKLKKLSIKKNFKFSRGEIFFKKIIKIKKEFFDHLSNINLLFYLNDCNLEKSFNMIIEYYQSVLHSEPFKYLILILLKIGNKCNKHEIKAFKLSTVESFIRIKNNRNKTLLELSFIKLKNVNINXIYELLSDLSKIELSESISXKELETEINNLKKNECKEKKVRERIDKILGKYDEYLGCQNKFYEYLGELSDDGVRIIYKELRNFVNNENKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.79
4 0.75
5 0.67
6 0.62
7 0.52
8 0.43
9 0.37
10 0.36
11 0.32
12 0.25
13 0.26
14 0.26
15 0.35
16 0.34
17 0.36
18 0.32
19 0.34
20 0.33
21 0.3
22 0.35
23 0.27
24 0.27
25 0.25
26 0.24
27 0.23
28 0.27
29 0.28
30 0.2
31 0.2
32 0.18
33 0.18
34 0.15
35 0.14
36 0.11
37 0.09
38 0.09
39 0.1
40 0.14
41 0.18
42 0.26
43 0.34
44 0.44
45 0.52
46 0.6
47 0.64
48 0.68
49 0.68
50 0.65
51 0.62
52 0.56
53 0.54
54 0.48
55 0.47
56 0.41
57 0.38
58 0.36
59 0.36
60 0.31
61 0.25
62 0.28
63 0.23
64 0.25
65 0.25
66 0.28
67 0.24
68 0.24
69 0.28
70 0.23
71 0.24
72 0.21
73 0.21
74 0.19
75 0.18
76 0.2
77 0.18
78 0.16
79 0.14
80 0.14
81 0.12
82 0.09
83 0.1
84 0.08
85 0.06
86 0.06
87 0.06
88 0.07
89 0.06
90 0.07
91 0.07
92 0.07
93 0.06
94 0.07
95 0.08
96 0.09
97 0.1
98 0.11
99 0.11
100 0.12
101 0.14
102 0.15
103 0.13
104 0.13
105 0.11
106 0.11
107 0.11
108 0.09
109 0.08
110 0.06
111 0.07
112 0.06
113 0.06
114 0.05
115 0.04
116 0.06
117 0.07
118 0.09
119 0.12
120 0.13
121 0.13
122 0.15
123 0.15
124 0.15
125 0.15
126 0.15
127 0.19
128 0.23
129 0.22
130 0.22
131 0.23
132 0.26
133 0.34
134 0.42
135 0.46
136 0.53
137 0.56
138 0.66
139 0.68
140 0.68
141 0.64
142 0.56
143 0.56
144 0.49
145 0.5
146 0.41
147 0.42
148 0.4
149 0.37
150 0.38
151 0.32
152 0.33
153 0.35
154 0.38
155 0.38
156 0.41
157 0.44
158 0.44
159 0.43
160 0.42
161 0.38
162 0.34
163 0.31
164 0.25
165 0.2
166 0.18
167 0.13
168 0.08
169 0.07
170 0.05
171 0.06
172 0.06
173 0.08
174 0.08
175 0.09
176 0.1
177 0.11
178 0.1
179 0.11
180 0.12
181 0.11
182 0.11
183 0.1
184 0.1
185 0.1
186 0.11
187 0.09
188 0.08
189 0.08
190 0.08
191 0.08
192 0.1
193 0.11
194 0.11
195 0.11
196 0.12
197 0.12
198 0.11
199 0.11
200 0.12
201 0.11
202 0.11
203 0.11
204 0.13
205 0.15
206 0.16
207 0.2
208 0.22
209 0.23
210 0.26
211 0.35
212 0.34
213 0.36
214 0.43
215 0.45
216 0.47
217 0.55
218 0.52
219 0.44
220 0.42
221 0.39
222 0.33
223 0.32
224 0.25
225 0.19
226 0.21
227 0.21
228 0.28
229 0.3
230 0.37
231 0.42
232 0.51
233 0.54
234 0.55
235 0.55
236 0.52
237 0.58
238 0.5
239 0.44
240 0.37
241 0.32
242 0.37
243 0.35
244 0.31
245 0.25
246 0.26
247 0.29
248 0.29
249 0.3
250 0.23
251 0.26
252 0.25
253 0.22
254 0.21
255 0.14
256 0.12
257 0.1
258 0.09
259 0.07
260 0.07
261 0.07
262 0.06
263 0.07
264 0.08
265 0.11
266 0.17
267 0.19
268 0.21
269 0.21
270 0.21
271 0.2
272 0.2
273 0.2
274 0.15
275 0.18
276 0.23
277 0.29
278 0.33
279 0.33
280 0.35
281 0.38
282 0.43
283 0.5
284 0.5
285 0.54
286 0.6
287 0.7
288 0.79
289 0.84
290 0.88
291 0.87
292 0.87
293 0.85
294 0.86
295 0.81
296 0.73
297 0.71
298 0.62
299 0.54
300 0.48
301 0.45
302 0.36
303 0.33
304 0.37
305 0.33
306 0.33
307 0.33
308 0.31
309 0.29
310 0.28
311 0.26
312 0.22
313 0.18
314 0.19
315 0.18
316 0.19
317 0.17
318 0.17
319 0.17
320 0.13
321 0.12
322 0.11
323 0.1
324 0.09
325 0.12
326 0.18
327 0.22
328 0.27
329 0.31
330 0.36
331 0.4
332 0.43
333 0.48