Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AJD1

Protein Details
Accession A0A437AJD1    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MRGRKSKELKFKNLQKSHKNNKFKTLKQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MRGRKSKELKFKNLQKSHKNNKFKTLKQLQKTMETEELKYMSIFTNKSARPPKKLCDITGLPAKYTCPRTGLYFFDTACYDLICESRMENNDKIKSLRFFGADLNPFKKKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.87
4 0.89
5 0.88
6 0.89
7 0.82
8 0.83
9 0.83
10 0.77
11 0.77
12 0.76
13 0.75
14 0.71
15 0.75
16 0.68
17 0.66
18 0.63
19 0.57
20 0.54
21 0.46
22 0.41
23 0.35
24 0.32
25 0.24
26 0.22
27 0.19
28 0.13
29 0.14
30 0.13
31 0.13
32 0.19
33 0.19
34 0.27
35 0.36
36 0.38
37 0.43
38 0.46
39 0.48
40 0.51
41 0.53
42 0.46
43 0.43
44 0.41
45 0.37
46 0.4
47 0.37
48 0.27
49 0.25
50 0.25
51 0.23
52 0.25
53 0.21
54 0.17
55 0.18
56 0.22
57 0.25
58 0.26
59 0.25
60 0.24
61 0.23
62 0.23
63 0.22
64 0.19
65 0.16
66 0.13
67 0.1
68 0.08
69 0.09
70 0.08
71 0.08
72 0.08
73 0.13
74 0.17
75 0.22
76 0.26
77 0.33
78 0.35
79 0.38
80 0.39
81 0.4
82 0.39
83 0.38
84 0.37
85 0.31
86 0.28
87 0.3
88 0.36
89 0.37
90 0.4
91 0.43