Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AP21

Protein Details
Accession A0A437AP21   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
269-291KENDFKCFRKSNFKKYPFKIFYQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
Amino Acid Sequences MTENQPSIVLSDSVVEQTDIKTILKNTPLHKLTTLLKITVEELCTFNACQERDLRHKSVYLTSKFIKNHLQKAQKNLSEKEFDILVSSLLERKKDICSQIRSLVVQTIGFLVLKKERNHFDFIFEALNDSNSFTVLTAIKSIKELLVLCKNSDFKKKLLKNIEFLINLAKNDKNKGIKEESSLLIFNLYEKKMINLESIKEIIHLAPLNLFKQMVDELIGYKREEPGYNFIFKDYNLMIKLYQFNNEIFTRINYTEVDLECFIKLLLEKENDFXXXKCFRKSNFKKYPFKIFYQFNLQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.1
5 0.13
6 0.13
7 0.13
8 0.15
9 0.17
10 0.22
11 0.28
12 0.33
13 0.33
14 0.42
15 0.43
16 0.43
17 0.42
18 0.41
19 0.38
20 0.42
21 0.41
22 0.32
23 0.31
24 0.29
25 0.29
26 0.28
27 0.25
28 0.18
29 0.16
30 0.16
31 0.17
32 0.16
33 0.18
34 0.21
35 0.19
36 0.2
37 0.24
38 0.29
39 0.36
40 0.43
41 0.44
42 0.4
43 0.43
44 0.43
45 0.46
46 0.48
47 0.43
48 0.42
49 0.42
50 0.46
51 0.44
52 0.45
53 0.47
54 0.45
55 0.5
56 0.54
57 0.61
58 0.58
59 0.66
60 0.71
61 0.66
62 0.66
63 0.6
64 0.56
65 0.5
66 0.47
67 0.39
68 0.3
69 0.25
70 0.21
71 0.17
72 0.13
73 0.09
74 0.09
75 0.11
76 0.12
77 0.13
78 0.12
79 0.14
80 0.18
81 0.22
82 0.28
83 0.32
84 0.36
85 0.4
86 0.43
87 0.44
88 0.4
89 0.36
90 0.31
91 0.24
92 0.19
93 0.15
94 0.11
95 0.09
96 0.09
97 0.08
98 0.08
99 0.12
100 0.18
101 0.19
102 0.24
103 0.28
104 0.31
105 0.36
106 0.35
107 0.33
108 0.28
109 0.27
110 0.23
111 0.19
112 0.17
113 0.11
114 0.12
115 0.09
116 0.08
117 0.07
118 0.06
119 0.06
120 0.05
121 0.07
122 0.06
123 0.07
124 0.09
125 0.09
126 0.09
127 0.09
128 0.1
129 0.08
130 0.09
131 0.09
132 0.11
133 0.17
134 0.17
135 0.17
136 0.19
137 0.22
138 0.23
139 0.31
140 0.29
141 0.26
142 0.36
143 0.39
144 0.45
145 0.52
146 0.52
147 0.47
148 0.48
149 0.49
150 0.39
151 0.36
152 0.32
153 0.24
154 0.21
155 0.21
156 0.2
157 0.16
158 0.18
159 0.23
160 0.24
161 0.24
162 0.29
163 0.32
164 0.31
165 0.33
166 0.34
167 0.3
168 0.26
169 0.25
170 0.2
171 0.15
172 0.14
173 0.12
174 0.13
175 0.12
176 0.12
177 0.11
178 0.13
179 0.14
180 0.15
181 0.17
182 0.15
183 0.16
184 0.17
185 0.18
186 0.17
187 0.16
188 0.15
189 0.11
190 0.12
191 0.11
192 0.09
193 0.12
194 0.13
195 0.13
196 0.14
197 0.13
198 0.11
199 0.12
200 0.12
201 0.09
202 0.08
203 0.08
204 0.09
205 0.12
206 0.14
207 0.13
208 0.14
209 0.16
210 0.17
211 0.19
212 0.2
213 0.24
214 0.26
215 0.3
216 0.29
217 0.27
218 0.26
219 0.24
220 0.26
221 0.2
222 0.2
223 0.18
224 0.18
225 0.18
226 0.2
227 0.26
228 0.22
229 0.25
230 0.23
231 0.22
232 0.26
233 0.26
234 0.24
235 0.2
236 0.2
237 0.22
238 0.2
239 0.22
240 0.18
241 0.2
242 0.23
243 0.22
244 0.24
245 0.2
246 0.2
247 0.18
248 0.18
249 0.16
250 0.12
251 0.13
252 0.11
253 0.16
254 0.19
255 0.21
256 0.28
257 0.32
258 0.35
259 0.37
260 0.38
261 0.39
262 0.44
263 0.47
264 0.52
265 0.57
266 0.64
267 0.72
268 0.8
269 0.83
270 0.8
271 0.87
272 0.81
273 0.79
274 0.76
275 0.71
276 0.67