Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AML3

Protein Details
Accession A0A437AML3    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSRTKDSRKKLEGRMRKAAREBasic
52-72ERENKIREKKEAKKRRQELEEBasic
NLS Segment(s)
PositionSequence
7-25SRKKLEGRMRKAAREEEKR
53-67RENKIREKKEAKKRR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSRTKDSRKKLEGRMRKAAREEEKRLEEERRQEEIEAATWLIGAKDNSKEIERENKIREKKEAKKRRQELEEEEVXXIXXXKXXXXXXXNTFXXFLNGXXXXXXXXIXFXIXXXXXFFYFFNFFIKNDSFYFVLCLTCGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.77
4 0.74
5 0.72
6 0.71
7 0.7
8 0.68
9 0.66
10 0.64
11 0.61
12 0.59
13 0.56
14 0.51
15 0.51
16 0.5
17 0.46
18 0.42
19 0.39
20 0.38
21 0.33
22 0.28
23 0.21
24 0.14
25 0.1
26 0.09
27 0.08
28 0.07
29 0.07
30 0.06
31 0.08
32 0.09
33 0.1
34 0.11
35 0.12
36 0.13
37 0.14
38 0.23
39 0.25
40 0.28
41 0.32
42 0.39
43 0.43
44 0.44
45 0.49
46 0.49
47 0.55
48 0.61
49 0.67
50 0.7
51 0.75
52 0.81
53 0.82
54 0.78
55 0.74
56 0.7
57 0.66
58 0.62
59 0.54
60 0.47
61 0.4
62 0.34
63 0.29
64 0.22
65 0.15
66 0.1
67 0.07
68 0.06
69 0.08
70 0.08
71 0.09
72 0.09
73 0.09
74 0.1
75 0.1
76 0.12
77 0.11
78 0.11
79 0.12
80 0.13
81 0.14
82 0.17
83 0.19
84 0.2
85 0.19
86 0.22
87 0.21
88 0.2
89 0.23
90 0.18
91 0.17