Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437AM06

Protein Details
Accession A0A437AM06    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
78-121MEKLESKRKKGLSRRARKTERKQKAKMFGTLRRHVKKQEKRQNKBasic
NLS Segment(s)
PositionSequence
83-121SKRKKGLSRRARKTERKQKAKMFGTLRRHVKKQEKRQNK
Subcellular Location(s) nucl 24, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MQTEITSVKENPLLNRKELTVSVTHEQKGTPSQKVITSVLSNLFKTKESNIIVKNIVTRFGSHSSKCNVRVYDDPEVMEKLESKRKKGLSRRARKTERKQKAKMFGTLRRHVKKQEKRQNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.37
4 0.35
5 0.34
6 0.3
7 0.24
8 0.26
9 0.28
10 0.31
11 0.3
12 0.28
13 0.27
14 0.26
15 0.31
16 0.3
17 0.28
18 0.26
19 0.27
20 0.28
21 0.31
22 0.3
23 0.25
24 0.21
25 0.2
26 0.23
27 0.22
28 0.21
29 0.19
30 0.19
31 0.17
32 0.17
33 0.17
34 0.19
35 0.19
36 0.24
37 0.24
38 0.26
39 0.25
40 0.24
41 0.27
42 0.2
43 0.2
44 0.16
45 0.15
46 0.15
47 0.2
48 0.22
49 0.19
50 0.23
51 0.24
52 0.28
53 0.31
54 0.32
55 0.27
56 0.28
57 0.31
58 0.33
59 0.36
60 0.32
61 0.3
62 0.26
63 0.26
64 0.23
65 0.19
66 0.16
67 0.14
68 0.23
69 0.25
70 0.27
71 0.34
72 0.4
73 0.49
74 0.56
75 0.63
76 0.65
77 0.74
78 0.81
79 0.85
80 0.89
81 0.9
82 0.92
83 0.92
84 0.92
85 0.91
86 0.9
87 0.89
88 0.89
89 0.84
90 0.81
91 0.78
92 0.76
93 0.75
94 0.75
95 0.76
96 0.73
97 0.73
98 0.74
99 0.77
100 0.79
101 0.81