Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AL89

Protein Details
Accession A0A437AL89    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
177-212EKYKQFEKEKRKESEEKKRRERLPYARTHKKKEESSBasic
NLS Segment(s)
PositionSequence
184-208KEKRKESEEKKRRERLPYARTHKKK
Subcellular Location(s) nucl 16, mito 11
Family & Domain DBs
Amino Acid Sequences MFMFLPFFFKNVILSEKKPSVFYKEKVTQFEKMLNLLKEGDLVECVLFASENFDYNAEEKLEKAECKCQALFELRKEINLQIQGLLNEMAKESPLSKTEDESSHKEIRQLSDKLMKKYLKSLQISRQNQLCGKENQHTRKQSTIKFVNLSLQNDGKEKNKKEFLGVGSLKMTFNPFEKYKQFEKEKRKESEEKKRRERLPYARTHKKKEESSITFDSSDEEREERIKKLEEKRQKLLQEIKIEMAARGITEEKKYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.34
3 0.38
4 0.39
5 0.41
6 0.41
7 0.43
8 0.46
9 0.47
10 0.49
11 0.52
12 0.56
13 0.6
14 0.62
15 0.57
16 0.52
17 0.55
18 0.47
19 0.43
20 0.43
21 0.37
22 0.34
23 0.3
24 0.27
25 0.23
26 0.21
27 0.17
28 0.11
29 0.11
30 0.09
31 0.08
32 0.08
33 0.06
34 0.06
35 0.05
36 0.09
37 0.09
38 0.1
39 0.11
40 0.11
41 0.12
42 0.13
43 0.15
44 0.12
45 0.12
46 0.11
47 0.14
48 0.17
49 0.18
50 0.2
51 0.25
52 0.26
53 0.3
54 0.3
55 0.27
56 0.28
57 0.34
58 0.37
59 0.33
60 0.39
61 0.35
62 0.36
63 0.37
64 0.34
65 0.3
66 0.27
67 0.24
68 0.17
69 0.18
70 0.17
71 0.16
72 0.16
73 0.11
74 0.09
75 0.09
76 0.07
77 0.06
78 0.07
79 0.07
80 0.08
81 0.09
82 0.13
83 0.13
84 0.15
85 0.18
86 0.21
87 0.25
88 0.28
89 0.32
90 0.33
91 0.33
92 0.35
93 0.34
94 0.33
95 0.36
96 0.32
97 0.29
98 0.34
99 0.37
100 0.37
101 0.42
102 0.4
103 0.34
104 0.39
105 0.42
106 0.4
107 0.4
108 0.42
109 0.43
110 0.52
111 0.54
112 0.5
113 0.48
114 0.42
115 0.41
116 0.39
117 0.35
118 0.27
119 0.28
120 0.32
121 0.36
122 0.41
123 0.46
124 0.49
125 0.47
126 0.51
127 0.54
128 0.51
129 0.52
130 0.5
131 0.45
132 0.42
133 0.4
134 0.39
135 0.36
136 0.34
137 0.28
138 0.25
139 0.23
140 0.23
141 0.24
142 0.24
143 0.29
144 0.3
145 0.34
146 0.38
147 0.37
148 0.38
149 0.41
150 0.36
151 0.38
152 0.35
153 0.3
154 0.25
155 0.26
156 0.23
157 0.19
158 0.19
159 0.11
160 0.12
161 0.16
162 0.17
163 0.21
164 0.24
165 0.29
166 0.34
167 0.41
168 0.49
169 0.53
170 0.63
171 0.67
172 0.74
173 0.74
174 0.76
175 0.77
176 0.78
177 0.8
178 0.79
179 0.8
180 0.81
181 0.84
182 0.83
183 0.82
184 0.82
185 0.81
186 0.81
187 0.81
188 0.81
189 0.83
190 0.84
191 0.84
192 0.83
193 0.81
194 0.78
195 0.76
196 0.76
197 0.7
198 0.7
199 0.67
200 0.6
201 0.52
202 0.46
203 0.4
204 0.3
205 0.27
206 0.22
207 0.18
208 0.16
209 0.21
210 0.24
211 0.24
212 0.28
213 0.32
214 0.38
215 0.47
216 0.56
217 0.62
218 0.67
219 0.72
220 0.76
221 0.73
222 0.73
223 0.73
224 0.69
225 0.66
226 0.61
227 0.55
228 0.5
229 0.47
230 0.39
231 0.31
232 0.24
233 0.16
234 0.16
235 0.17
236 0.17