Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437AQB0

Protein Details
Accession A0A437AQB0    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
62-84AFSRSVKKTSKKLKDKYYRTLFMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.833, cyto 4.5, cyto_mito 3.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR042855  V_SNARE_CC  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00957  Synaptobrevin  
PROSITE View protein in PROSITE  
PS50892  V_SNARE  
Amino Acid Sequences MLYDKRNKELLEKDTVTLKKLEKETDDFIKEQIKLLKQAYERYNSISELENQSNELEMKSTAFSRSVKKTSKKLKDKYYRTLFMILFVVLVVFSIGYFTNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.41
4 0.37
5 0.35
6 0.32
7 0.34
8 0.36
9 0.32
10 0.35
11 0.38
12 0.4
13 0.41
14 0.35
15 0.33
16 0.34
17 0.3
18 0.29
19 0.29
20 0.24
21 0.25
22 0.25
23 0.29
24 0.26
25 0.33
26 0.33
27 0.33
28 0.31
29 0.31
30 0.31
31 0.26
32 0.26
33 0.2
34 0.19
35 0.19
36 0.19
37 0.15
38 0.15
39 0.14
40 0.13
41 0.12
42 0.1
43 0.07
44 0.06
45 0.07
46 0.07
47 0.08
48 0.08
49 0.1
50 0.12
51 0.17
52 0.23
53 0.29
54 0.36
55 0.42
56 0.51
57 0.59
58 0.68
59 0.73
60 0.76
61 0.8
62 0.83
63 0.84
64 0.86
65 0.84
66 0.78
67 0.7
68 0.68
69 0.57
70 0.48
71 0.41
72 0.31
73 0.21
74 0.16
75 0.13
76 0.07
77 0.07
78 0.05
79 0.03
80 0.03
81 0.04