Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437APF5

Protein Details
Accession A0A437APF5   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-29THITEKNNLKRNRQKKRRADSYYRKKQLGHydrophilic
NLS Segment(s)
PositionSequence
10-18KRNRQKKRR
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
Amino Acid Sequences THITEKNNLKRNRQKKRRADSYYRKKQLGTVYKQDIIGTCPQATGIVLEKIQVGAKQPNSAIRKGVRVQLIKNGTKVSAFVPLDGSINHIDLNDIVTLKGFGKGNKSKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.93
4 0.93
5 0.91
6 0.92
7 0.92
8 0.92
9 0.93
10 0.89
11 0.8
12 0.69
13 0.65
14 0.64
15 0.62
16 0.58
17 0.55
18 0.53
19 0.53
20 0.52
21 0.48
22 0.38
23 0.31
24 0.28
25 0.21
26 0.16
27 0.14
28 0.14
29 0.13
30 0.13
31 0.11
32 0.09
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.09
39 0.08
40 0.08
41 0.11
42 0.12
43 0.13
44 0.13
45 0.2
46 0.23
47 0.23
48 0.24
49 0.22
50 0.26
51 0.27
52 0.31
53 0.3
54 0.3
55 0.3
56 0.35
57 0.4
58 0.37
59 0.37
60 0.33
61 0.27
62 0.25
63 0.25
64 0.18
65 0.19
66 0.18
67 0.16
68 0.17
69 0.17
70 0.18
71 0.17
72 0.19
73 0.12
74 0.12
75 0.12
76 0.1
77 0.1
78 0.09
79 0.11
80 0.09
81 0.08
82 0.08
83 0.08
84 0.09
85 0.1
86 0.14
87 0.15
88 0.16
89 0.25