Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AMP4

Protein Details
Accession A0A437AMP4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-45VVRNMKSLSHRKNSPKSKRKREAEKINKENCFKHydrophilic
NLS Segment(s)
PositionSequence
22-36HRKNSPKSKRKREAE
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
Amino Acid Sequences MFAQSSSEEEMIVVRNMKSLSHRKNSPKSKRKREAEKINKENCFKCNKPLRPTNKFGCKCGNSFCMIHRFNDQHNCPYNFKALTIKKLKQENPQVINKKVTEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.15
4 0.16
5 0.22
6 0.3
7 0.37
8 0.43
9 0.52
10 0.58
11 0.69
12 0.78
13 0.82
14 0.82
15 0.85
16 0.88
17 0.9
18 0.9
19 0.91
20 0.91
21 0.91
22 0.91
23 0.91
24 0.9
25 0.87
26 0.83
27 0.76
28 0.68
29 0.61
30 0.58
31 0.48
32 0.48
33 0.51
34 0.52
35 0.55
36 0.61
37 0.65
38 0.64
39 0.69
40 0.68
41 0.68
42 0.63
43 0.59
44 0.58
45 0.51
46 0.46
47 0.44
48 0.39
49 0.31
50 0.3
51 0.3
52 0.31
53 0.29
54 0.29
55 0.3
56 0.3
57 0.32
58 0.41
59 0.41
60 0.39
61 0.46
62 0.49
63 0.46
64 0.46
65 0.46
66 0.37
67 0.36
68 0.38
69 0.34
70 0.39
71 0.45
72 0.48
73 0.5
74 0.59
75 0.63
76 0.63
77 0.7
78 0.7
79 0.69
80 0.74
81 0.74
82 0.7
83 0.71